DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Damm and CASP7

DIOPT Version :9

Sequence 1:NP_001303345.1 Gene:Damm / 36266 FlyBaseID:FBgn0033659 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001253986.1 Gene:CASP7 / 840 HGNCID:1508 Length:388 Species:Homo sapiens


Alignment Length:308 Identity:77/308 - (25%)
Similarity:118/308 - (38%) Gaps:75/308 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RTEHQKIE--------RLYDSNRVNAEPGQG-LDLNEKLK---------------PPAVYILNHE 46
            |.:..||:        |||   |.::.|..| |....|.|               |...|.:|.|
Human    89 RIQQMKIQWMLSQTGPRLY---RPSSAPDSGTLYFTSKKKKNVTMRSIKTTRDRVPTYQYNMNFE 150

  Fly    47 QFPQDSQLN------------RKGSSNDVNALRKTFESLKCRVEVISNPALPDVKNKVKEWSAKR 99
            :..:...:|            |.|:..|..||.|.|.||...|.|.::.:...:::.:|:.|.:.
Human   151 KLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQDLLKKASEED 215

  Fly   100 FTQDAGFVLFILSHGDR-----KEKILACDHREYHLDDDVLFPLFRNPTLSGKPKILIVQACKGP 159
            .|..|.|...:||||:.     |:.:........|...|      |..||..|||:..:|||:|.
Human   216 HTNAACFACILLSHGEENVIYGKDGVTPIKDLTAHFRGD------RCKTLLEKPKLFFIQACRGT 274

  Fly   160 -----LRADAKKMNN------------EPYIKCYSCSEGYLSYRNENHGSVFIQTLCEAMDQYGL 207
                 ::||:..:|:            ..::..||...||.|:|:...||.|:|.||..::::|.
Human   275 ELDDGIQADSGPINDTDANPRYKIPVEADFLFAYSTVPGYYSWRSPGRGSWFVQALCSILEEHGK 339

  Fly   208 TRDFQSIFKHVKAEVERRSTMTG-------SKQVPSEESHNFDKPFYF 248
            ..:...|...|...|.|......       .||:|...| ...|..||
Human   340 DLEIMQILTRVNDRVARHFESQSDDPHFHEKKQIPCVVS-MLTKELYF 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DammNP_001303345.1 Peptidase_C14 42..248 CDD:279049 61/246 (25%)
CASP7NP_001253986.1 CASc 145..386 CDD:237997 62/247 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
32.770

Return to query results.
Submit another query.