DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Damm and CASP6

DIOPT Version :9

Sequence 1:NP_001303345.1 Gene:Damm / 36266 FlyBaseID:FBgn0033659 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001217.2 Gene:CASP6 / 839 HGNCID:1507 Length:293 Species:Homo sapiens


Alignment Length:270 Identity:75/270 - (27%)
Similarity:120/270 - (44%) Gaps:59/270 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 EPGQGLDLNEKLKPPAVYILNHEQF------PQDSQLNRKGSSNDVNALRKTFESLKCRVEVISN 82
            :|.:...::.:.:..|: |.|||:|      |:     |:|:..|.:.|.:.|..|...|:..::
Human    32 DPAEKYKMDHRRRGIAL-IFNHERFFWHLTLPE-----RRGTCADRDNLTRRFSDLGFEVKCFND 90

  Fly    83 PALPDVKNKVKEWSAKRFTQDAGFVLFILSHGDRKEKILACDHREYHLDDDVLFPLFRNP---TL 144
            ....::..|:.|.|.........||...||||:... |.|.|.:   ::...|..||:..   :|
Human    91 LKAEELLLKIHEVSTVSHADADCFVCVFLSHGEGNH-IYAYDAK---IEIQTLTGLFKGDKCHSL 151

  Fly   145 SGKPKILIVQACKG--------PL---------------RADAKKMNNEP----YIKCYSCSEGY 182
            .|||||.|:|||:|        ||               ..||..:...|    ::.|||.:|||
Human   152 VGKPKIFIIQACRGNQHDVPVIPLDVVDNQTEKLDTNITEVDAASVYTLPAGADFLMCYSVAEGY 216

  Fly   183 LSYRNENHGSVFIQTLCEAMDQYGLTRDFQSIFKHVKAEVERR-------STMTGSKQVP----- 235
            .|:|...:||.:||.|||.:.:||.:.:|..:...|..:|.:|       .:..|.||||     
Human   217 YSHRETVNGSWYIQDLCEMLGKYGSSLEFTELLTLVNRKVSQRRVDFCKDPSAIGKKQVPCFASM 281

  Fly   236 -SEESHNFDK 244
             :::.|.|.|
Human   282 LTKKLHFFPK 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DammNP_001303345.1 Peptidase_C14 42..248 CDD:279049 73/252 (29%)
CASP6NP_001217.2 CASc 37..290 CDD:214521 72/262 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
32.770

Return to query results.
Submit another query.