Sequence 1: | NP_001303345.1 | Gene: | Damm / 36266 | FlyBaseID: | FBgn0033659 | Length: | 255 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001216.1 | Gene: | CASP4 / 837 | HGNCID: | 1505 | Length: | 377 | Species: | Homo sapiens |
Alignment Length: | 339 | Identity: | 75/339 - (22%) |
---|---|---|---|
Similarity: | 126/339 - (37%) | Gaps: | 96/339 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 2 YLPERTEHQKIERLYDS-----------------NRVNAEPGQGLDLNEKLKPP-------AVYI 42
Fly 43 LNHEQF------------PQDSQLN------------------RKGSSNDVNALRKTFESLKCRV 77
Fly 78 EVISNPALPDVKNKVKEWSAK--RFTQDAGFVLFILSHGDRKEKILACDHREYHLD---DDVLFP 137
Fly 138 LFRNP---TLSGKPKILIVQACKGPLRAD------------AKKMNNE--------------PYI 173
Fly 174 KCYSCSEGYLSYRNENHGSVFIQTLCEAMDQYGLTRDFQSIFKHVKAEVERRSTMTGSKQVPSEE 238
Fly 239 SHNFDKPFYF--GN 250 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Damm | NP_001303345.1 | Peptidase_C14 | 42..248 | CDD:279049 | 60/269 (22%) |
CASP4 | NP_001216.1 | Required for LPS-binding. /evidence=ECO:0000250|UniProtKB:P70343 | 1..59 | 4/14 (29%) | |
CARD_CASP1-like | 5..81 | CDD:260036 | 7/36 (19%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 84..104 | 4/19 (21%) | |||
CASc | 126..375 | CDD:214521 | 58/253 (23%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3573 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |