DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Damm and CASP3

DIOPT Version :9

Sequence 1:NP_001303345.1 Gene:Damm / 36266 FlyBaseID:FBgn0033659 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001341706.1 Gene:CASP3 / 836 HGNCID:1504 Length:277 Species:Homo sapiens


Alignment Length:280 Identity:77/280 - (27%)
Similarity:125/280 - (44%) Gaps:66/280 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 QKIERLYDSNRV-NAEP-----------GQGLDLNEKLKPPAV---YILNHEQFPQDSQL-NRKG 58
            :..|...||..: |.||           |..||.:.|:..|.:   .|:|::.|.:.:.: :|.|
Human     2 ENTENSVDSKSIKNLEPKIIHGSESMDSGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSG 66

  Fly    59 SSNDVNALRKTFESLKCRVEVISNPALPDVKNKVKEWSAKRFTQDAGFVLFILSHGDRKEKILAC 123
            :..|...||:||.:||..|...::....::...:::.|.:..::.:.||..:||||:  |.|:..
Human    67 TDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGE--EGIIFG 129

  Fly   124 DHREYHLDDDVLFPLFRNP---TLSGKPKILIVQACKG----------------------PLRAD 163
            .:....|.....|  ||..   :|:||||:.|:|||:|                      |:.||
Human   130 TNGPVDLKKITNF--FRGDRCRSLTGKPKLFIIQACRGTELDCGIETDSGVDDDMACHKIPVEAD 192

  Fly   164 AKKMNNEPYIKCYSCSEGYLSYRNENHGSVFIQTLCEAMDQYGLTRDFQSIFKHVKAEVERRSTM 228
                    ::..||.:.||.|:||...||.|||:||..:.||....:|.    |:...|.|:   
Human   193 --------FLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFM----HILTRVNRK--- 242

  Fly   229 TGSKQVPSE-ESHNFDKPFY 247
                 |.:| ||.:||..|:
Human   243 -----VATEFESFSFDATFH 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DammNP_001303345.1 Peptidase_C14 42..248 CDD:279049 66/233 (28%)
CASP3NP_001341706.1 CASc 37..277 CDD:214521 68/245 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
32.770

Return to query results.
Submit another query.