DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Damm and casp6b.1

DIOPT Version :9

Sequence 1:NP_001303345.1 Gene:Damm / 36266 FlyBaseID:FBgn0033659 Length:255 Species:Drosophila melanogaster
Sequence 2:XP_005164109.1 Gene:casp6b.1 / 791531 ZFINID:ZDB-GENE-041010-48 Length:279 Species:Danio rerio


Alignment Length:276 Identity:81/276 - (29%)
Similarity:117/276 - (42%) Gaps:55/276 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 KIERLYDSNRVNAEPGQGLDLNEKLKPPAVYILNHEQFPQDSQL---NRKGSSNDVNALRKTFES 72
            :|:.:|        |.|..|:....:..|: |.|.:||  |.:|   .|.|:..|.:.|...|:.
Zfish    19 RIQSVY--------PNQEYDMRHARRGMAL-IFNQKQF--DWKLGLKTRNGTDKDRDDLVSRFQE 72

  Fly    73 LKCRVEVISNPALPDVKNKVKEWSAKRFTQDAGFVLFILSHGDRKEKILACDHREYHLDDDVLFP 137
            |...|:..::.:..||..|::|.||........||...||||:        |...|..|..:..|
Zfish    73 LNFEVKAYNDYSRDDVLLKIQEASAADHVDADCFVCIFLSHGE--------DGHVYANDKKIEIP 129

  Fly   138 ----LFRNP---TLSGKPKILIVQACKGPLRADA-KKMNNE------------------PYIKCY 176
                ||:..   :|.|||||.|.|||:|....|| .:|:.|                  .:|.||
Zfish   130 EITDLFKGDKCRSLVGKPKIFIWQACRGDKLDDAVTEMSVEDVEMAVDAGVLYTLPAGADFIMCY 194

  Fly   177 SCSEGYLSYRNENHGSVFIQTLCEAMDQYGLTRDFQSIFKHVKAEVERRS-------TMTGSKQV 234
            |.:||:.|:|...:||.:||.|||.:.:|.....|..|...|..:|..||       ...|.||:
Zfish   195 STAEGFCSFREPLNGSWYIQDLCEILGRYHSELQFTDILTLVNMKVSLRSVPNCRNRAAIGKKQM 259

  Fly   235 PSEESHNFDKPFYFGN 250
            |...|....:.|:..|
Zfish   260 PCFASMLTKRLFFRDN 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DammNP_001303345.1 Peptidase_C14 42..248 CDD:279049 74/241 (31%)
casp6b.1XP_005164109.1 CASc 29..272 CDD:237997 75/253 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.