DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Damm and Casp2

DIOPT Version :9

Sequence 1:NP_001303345.1 Gene:Damm / 36266 FlyBaseID:FBgn0033659 Length:255 Species:Drosophila melanogaster
Sequence 2:XP_038964243.1 Gene:Casp2 / 64314 RGDID:69274 Length:470 Species:Rattus norvegicus


Alignment Length:274 Identity:59/274 - (21%)
Similarity:100/274 - (36%) Gaps:74/274 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 RVNAEPGQGLDLNEKLKPPAVYILNHEQFPQDSQLN-RKGSSNDVNALRKTFESLKCRVEVISN- 82
            |:.::| :||.|          ::::..|..:..|. |.|...|...|...|:.|...|.|:.: 
  Rat   193 RLQSQP-RGLAL----------VMSNVHFTGEKDLEFRSGGDVDHTTLVTLFKLLGYNVHVLYDQ 246

  Fly    83 -----------------PALPDVKNKVKEWS---AKRFTQDAGFVLFILSHGDRKEKILACDHRE 127
                             |...:::.|::.::   |.|.|...  ::.:|||| .:..|...|.:.
  Rat   247 TAQFHRFQLYSGIYKKYPKGQEMQEKLQNFAQLPAHRVTDSC--IVALLSHG-VEGGIYGVDGKL 308

  Fly   128 YHLDDDVLFPLFRN---PTLSGKPKILIVQACKGPL------RADAKKMNNEP------------ 171
            ..|.:  :|.||.|   |:|..|||:..:|||:|..      :.|.|.....|            
  Rat   309 LQLQE--VFRLFDNANCPSLQNKPKMFFIQACRGDETDRGVDQQDGKNHAQSPGCEESDAGKEEL 371

  Fly   172 ----------YIKCYSCSEGYLSYRNENHGSVFIQTLCEAMDQYGLTRDFQSIFKHVKAEVERRS 226
                      .|..|:|.:|..:.||...||.:|:.|.:...:.........:...|.|.::.| 
  Rat   372 MKMRLPTRSDMICGYACLKGNAAMRNTKRGSWYIEALTQVFSERACDMHVADMLVKVNALIKER- 435

  Fly   227 TMTGSKQVPSEESH 240
                ....|..|.|
  Rat   436 ----EGYAPGTEFH 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DammNP_001303345.1 Peptidase_C14 42..248 CDD:279049 54/252 (21%)
Casp2XP_038964243.1 CARD_CASP2 32..118 CDD:260040
CASc 192..465 CDD:214521 59/274 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.