DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Damm and CARD18

DIOPT Version :10

Sequence 1:NP_523703.2 Gene:Damm / 36266 FlyBaseID:FBgn0033659 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_067546.1 Gene:CARD18 / 59082 HGNCID:28861 Length:90 Species:Homo sapiens


Alignment Length:61 Identity:15/61 - (24%)
Similarity:21/61 - (34%) Gaps:30/61 - (49%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 NPTLSGKPKILI-VQACKGPLRADAKKMNNEPYIKCYSCSEGYLSYRNENHGSVFIQTLCE 200
            |.|:..|.::|| :...|||                .||.:             ||:.|||
Human    47 NDTVMDKARVLIDLVTGKGP----------------KSCCK-------------FIKHLCE 78

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DammNP_523703.2 Peptidase_C14 42..247 CDD:425803 15/61 (25%)
CARD18NP_067546.1 CARD_CASP1-like 6..87 CDD:260036 15/61 (25%)

Return to query results.
Submit another query.