DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Damm and caspa

DIOPT Version :9

Sequence 1:NP_001303345.1 Gene:Damm / 36266 FlyBaseID:FBgn0033659 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_571580.1 Gene:caspa / 57933 ZFINID:ZDB-GENE-000616-3 Length:383 Species:Danio rerio


Alignment Length:259 Identity:59/259 - (22%)
Similarity:113/259 - (43%) Gaps:34/259 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 NRVNAEPGQ-GLDLNEK-LKPPAVYILNHEQFPQDSQLNRKGSSNDVNALRKTFESLKCRVEVIS 81
            |::..|.|| ..::.:| ::.....::|:..| .|..:.|.||..|...:.|..:.|..:|....
Zfish   124 NKILREKGQETYEIKDKSVRKRLALLINNVDF-DDKAMKRSGSEKDEENMEKLLKELDYQVVKRP 187

  Fly    82 NPALPDVKNKVKEWSAKRFTQ--DAGFVLFILSHGDRKEKILACDHREYHLDDDVLFP---LFRN 141
            |.:..::...:::::.:...:  |:.||: |:|||.|...:....||..:..|.  ||   ::|.
Zfish   188 NLSAKEMDEAIRDFAQREEHKYSDSAFVV-IMSHGKRDAIMGVHYHRTNNPSDS--FPVDNVYRR 249

  Fly   142 ------PTLSGKPKILIVQACKGPLRADAKKMNNEP-----------------YIKCYSCSEGYL 183
                  |.|..|||::::|||:|.........:.||                 :|...||:....
Zfish   250 LNSENCPALRDKPKVILIQACRGGEHGRVWASDGEPDEPIEIEDDDFVHKEKDFISLMSCTPDTK 314

  Fly   184 SYRNENHGSVFIQTLCEAMDQYGLTRDFQSIFKHVKAEVERRSTMTGSKQVPSEESHNFDKPFY 247
            |||:..:|:.::|||.:...:.......:.:|:.|....|..:.:...||:..::.....|.||
Zfish   315 SYRHVQNGTFYVQTLVDVFIKCAHEDHIEELFRKVLRRFEHPNMIGNFKQMACKDRATLPKLFY 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DammNP_001303345.1 Peptidase_C14 42..248 CDD:279049 54/234 (23%)
caspaNP_571580.1 DD 6..85 CDD:417479
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 87..106
CASc 134..380 CDD:237997 55/249 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.