DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Damm and casp3b

DIOPT Version :9

Sequence 1:NP_001303345.1 Gene:Damm / 36266 FlyBaseID:FBgn0033659 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001041531.2 Gene:casp3b / 566604 ZFINID:ZDB-GENE-070607-1 Length:285 Species:Danio rerio


Alignment Length:272 Identity:69/272 - (25%)
Similarity:114/272 - (41%) Gaps:66/272 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 IERLYDSNRVNAEPGQGLDLNEKLKPPAVYILNHEQFPQDSQLN-RKGSSNDVNALRKTFESLKC 75
            ::..|.:|..|.  ||.|            |:|::.|.:.:.:. |.|:..|...:.:||..|..
Zfish    43 VDYQYKTNYPNL--GQCL------------IINNKNFHKRTGMGVRNGTDEDAKKVFETFSQLGF 93

  Fly    76 RVEVISNPALPDVKNKVKEWSAKRFTQDAGFVLFILSHGDRKEKILACDHREYHLDDDV----LF 136
            :|...::..:..:...:.:.|.:..::.|.|...:|||||        |...|..|:.:    ||
Zfish    94 KVGHYNDLTVSQMMALLNKASQEDHSKSAMFACVLLSHGD--------DGLIYGTDNSIELKRLF 150

  Fly   137 PLFRN---PTLSGKPKILIVQACKG--------------------PLRADAKKMNNEPYIKCYSC 178
            ..||.   .:|.||||:..:|||:|                    |:.||        ::..||.
Zfish   151 AHFRGDRCTSLVGKPKLFFIQACRGTDLDSGIECDGVGDEETQRIPVEAD--------FLYAYST 207

  Fly   179 SEGYLSYRNENHGSVFIQTLCEAMDQYGLTRDFQSIFKHV--KAEVERRST-----MTGSKQVPS 236
            :.||.::||..:||.||.:||:.:.:||...:...:...|  |..:|..|:     ..|.||:|.
Zfish   208 APGYYAWRNVANGSWFISSLCDMLLKYGKQLEIMQVMTRVNHKVALEFESSSNLPGFDGKKQIPC 272

  Fly   237 EESHNFDKPFYF 248
            ..| ...|..||
Zfish   273 IVS-MLTKELYF 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DammNP_001303345.1 Peptidase_C14 42..248 CDD:279049 61/240 (25%)
casp3bNP_001041531.2 CASc 47..284 CDD:237997 69/268 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
32.770

Return to query results.
Submit another query.