powered by:
Protein Alignment Damm and pea15
DIOPT Version :9
Sequence 1: | NP_001303345.1 |
Gene: | Damm / 36266 |
FlyBaseID: | FBgn0033659 |
Length: | 255 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_683349.2 |
Gene: | pea15 / 557745 |
-ID: | - |
Length: | 130 |
Species: | Danio rerio |
Alignment Length: | 66 |
Identity: | 16/66 - (24%) |
Similarity: | 27/66 - (40%) |
Gaps: | 16/66 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 160 LRADAKKMNNEPYIKCYSCSEGYLSYRNENHGSVFIQTLCEAMDQYGLTRDFQSIFKHVKAEVER 224
|::..|:...|......:||..:.||..:| |: |.:|..|..:|: .|:.|
Zfish 23 LKSACKEDIPEEQSNSIACSRDWFSYLEKN-------------DK--LAQDNLSYIEHI-FEISR 71
Fly 225 R 225
|
Zfish 72 R 72
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3573 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.