DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Damm and casp10

DIOPT Version :9

Sequence 1:NP_001303345.1 Gene:Damm / 36266 FlyBaseID:FBgn0033659 Length:255 Species:Drosophila melanogaster
Sequence 2:XP_685430.4 Gene:casp10 / 557302 ZFINID:ZDB-GENE-070608-2 Length:520 Species:Danio rerio


Alignment Length:226 Identity:66/226 - (29%)
Similarity:99/226 - (43%) Gaps:34/226 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 ILNHEQFPQDSQLNRKGSSNDVNALRKTFESLKCRVEVISNPALPDVKNKVKEWSAKRFTQDAGF 106
            |:|:..|.....|||:|:..|.::||..||.|...:....:.....:...:.:.|.:..||....
Zfish   285 IINNYDFSACGWLNREGTDIDHDSLRDVFEWLGFEILTRRDCTGDQILQALMDLSTQDHTQADCV 349

  Fly   107 VLFILSHGDRKEKILACDHREYHLDD--DVLFPLFRNPTLSGKPKILIVQACKGP---------- 159
            |..||||| |...|:..|.:.....:  :.|.| ||..:|..|||:..:|||:|.          
Zfish   350 VCCILSHG-RLNDIIGVDGKAVPFKELMETLSP-FRCSSLYQKPKLFFIQACRGTQNQRAVFPQT 412

  Fly   160 -------LRADAKKMNNE-----PYIKCYSCSEGYLSYRNENHGSVFIQTLCEAMDQYGLT---- 208
                   |.:||....:.     .|:...|....|.|||:::.|:.|||:||   |...|.    
Zfish   413 FTEDEDVLASDAGVPRDSIPEMADYLMAMSTVPWYASYRDKSKGTWFIQSLC---DNLRLLVPRG 474

  Fly   209 RDFQSIFKHVKAEVERRSTMTG-SKQVPSEE 238
            .|..||...|.|:|.::|..:| .||:|..|
Zfish   475 NDLLSILTKVNADVSKKSDKSGLKKQMPQPE 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DammNP_001303345.1 Peptidase_C14 42..248 CDD:279049 66/226 (29%)
casp10XP_685430.4 DED_Caspase_8_10_r1 11..87 CDD:260059
DED_Caspase_8_10_r2 108..190 CDD:260042
DUF4603 <200..>256 CDD:292020
CASc 273..515 CDD:237997 66/226 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.