DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Damm and casp7

DIOPT Version :9

Sequence 1:NP_001303345.1 Gene:Damm / 36266 FlyBaseID:FBgn0033659 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001018443.1 Gene:casp7 / 553634 ZFINID:ZDB-GENE-050522-506 Length:316 Species:Danio rerio


Alignment Length:242 Identity:62/242 - (25%)
Similarity:101/242 - (41%) Gaps:44/242 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 ILNHEQFPQDSQLN-RKGSSNDVNALRKTFESLKCRVEVISNPALPDVKNKVKEWSAKRFTQDAG 105
            |:|::.|.:.:.:| |.|:..|...|.|.|:||...|.|.::....:::..:|..|.:..:..:.
Zfish    83 IINNKNFDEKTGMNVRNGTDRDAGELFKCFKSLGFDVAVYNDQTCRNMERLLKAVSEEDHSDSSC 147

  Fly   106 FVLFILSHGDRKEKILACDHREYHLDD----DVLFPLFRN---PTLSGKPKILIVQACKG----- 158
            |...:||||:  |.::      |..|.    ..:..||:.   .:|.||||:..:|||:|     
Zfish   148 FACILLSHGE--EGMI------YGTDGAMPIKTMTSLFKGDVCKSLVGKPKLFFIQACRGSEFDD 204

  Fly   159 -----------PLRADAKKMNNEP----YIKCYSCSEGYLSYRNENHGSVFIQTLCEAMDQYGLT 208
                       .:..||...:..|    ::..||...||.|:||...||.|:|.||..:.::|..
Zfish   205 GVQTDSGPPNDTIETDANPRHKIPVEADFLFAYSTVPGYYSWRNPGRGSWFVQALCNVLSEFGKQ 269

  Fly   209 RDFQSIFKHVKAEV-------ERRSTMTGSKQVPSEESHNFDKPFYF 248
            .:...|...|...|       ......:..||:|...| ...|..||
Zfish   270 LEIMQILTRVNYMVATSFESWSEDPRFSEKKQIPCVVS-MLTKELYF 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DammNP_001303345.1 Peptidase_C14 42..248 CDD:279049 60/240 (25%)
casp7NP_001018443.1 CASc 71..315 CDD:237997 60/240 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.