DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Damm and casp6a

DIOPT Version :9

Sequence 1:NP_001303345.1 Gene:Damm / 36266 FlyBaseID:FBgn0033659 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001018333.1 Gene:casp6a / 552927 ZFINID:ZDB-GENE-030825-4 Length:298 Species:Danio rerio


Alignment Length:278 Identity:81/278 - (29%)
Similarity:118/278 - (42%) Gaps:52/278 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 ERLYDSNRVN-----AEPGQGLDLNEKLKPPAVYILNHEQFPQDSQLN-RKGSSNDVNALRKTFE 71
            |.|.:::..|     .:|.|..|:|.|.:..|: |.|||.|.....|. |.|::.|...|.:.|.
Zfish    26 ENLTETDSFNQSIFSMDPNQEYDMNHKRRGMAL-IFNHENFFWKLGLGYRSGTNADKENLIRRFR 89

  Fly    72 SLKCRVEVISNPALPDVKNKVKEWSAKRFTQDAGFVLFILSHGDRKEKILACDHREYHLDDDVLF 136
            .|...|:...:....:|.:|:.|.:|.........|...||||:        :...|..|..:..
Zfish    90 ELNFEVKAFDDYKRHEVLSKITEAAAADHVDADCLVCVFLSHGE--------NGHVYANDGQIEI 146

  Fly   137 P----LFRNP---TLSGKPKILIVQACKG--------PLRADAKKMNNE---------------P 171
            |    ||:..   :|.|||||.|.|||:|        |:.....::.|:               .
Zfish   147 PEITDLFKGDKCRSLVGKPKIFIWQACRGDKHDDPVTPMDVVDSQVTNDMVVDAGVLYTLPAGAD 211

  Fly   172 YIKCYSCSEGYLSYRNENHGSVFIQTLCEAMDQYGLTRDFQSIFKHVKAEVERRSTM-------T 229
            :|.|||.:|||.|:|...:||.:||.|||.:.:||...:|..|...|..:|..||.:       .
Zfish   212 FIMCYSVAEGYYSHRETVNGSWYIQDLCEILRRYGSELEFAEILTLVNRKVSLRSVLNCKDRSAV 276

  Fly   230 GSKQVPSEESHNFDKPFY 247
            |.||||...|....|.|:
Zfish   277 GKKQVPCFASMLTKKLFF 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DammNP_001303345.1 Peptidase_C14 42..248 CDD:279049 72/244 (30%)
casp6aNP_001018333.1 CASc 47..294 CDD:237997 75/255 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
32.770

Return to query results.
Submit another query.