DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Damm and Decay

DIOPT Version :9

Sequence 1:NP_001303345.1 Gene:Damm / 36266 FlyBaseID:FBgn0033659 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_477462.1 Gene:Decay / 42008 FlyBaseID:FBgn0028381 Length:308 Species:Drosophila melanogaster


Alignment Length:295 Identity:67/295 - (22%)
Similarity:119/295 - (40%) Gaps:77/295 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ERTEHQKIERLYDSNRVNAEPGQGLDL---------NEK-----LKPPAVYILNHEQFPQDSQLN 55
            ::.:|:|.:.  |:.::...|...|||         ||.     .:.....||||:..  ..|..
  Fly    11 QKNKHKKDKA--DATKIAHTPTSELDLKRIIISRPTNEDTYENCARAGIALILNHKDV--KGQKQ 71

  Fly    56 RKGSSNDVNALRKTFESLKCRVEVISNPALPDVKNKVKEWSAKRFTQDAGFVLFILSHGDRKEKI 120
            |.|:..|.:.:..|.:.....|....:....::.:.:||.:.:..:|:..|||.::||| .:.|:
  Fly    72 RVGTERDRDDMEATLQGFGFDVRTFDDLTFSEINDTLKEVAREDHSQNDCFVLAVMSHG-TEGKV 135

  Fly   121 LACDHREYHLDDDVLFPLFR--NP-------TLSGKPKILIVQACKGPLRADAKKMNN------- 169
            .|         .|:.:|:.|  ||       ||..|||:..:|||:|.....|.:.::       
  Fly   136 YA---------KDMSYPVERLWNPFLGDNCKTLKNKPKLFFIQACRGANLEKAVEFSSFAVMTRE 191

  Fly   170 ---EP----------------YIKCYSCSEGYLSYRNENHGSVFIQTLCEAMDQYG--------- 206
               ||                .:..||..:.:.|:||.:.||.|||:||..:||..         
  Fly   192 LVPEPAAAVQPITYAIPSTADILVFYSTFDKFFSFRNVDDGSWFIQSLCRVLDQAAANEAATPEG 256

  Fly   207 --LTRDFQSIFKHVKAEVE---RRSTMTGSKQVPS 236
              |.|...::.:.|..|.:   :...:...|::|:
  Fly   257 VELLRLLTAVNRKVAYEYQSNTKNEALNQMKEMPN 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DammNP_001303345.1 Peptidase_C14 42..248 CDD:279049 58/244 (24%)
DecayNP_477462.1 CASc 54..302 CDD:237997 58/250 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.