Sequence 1: | NP_001303345.1 | Gene: | Damm / 36266 | FlyBaseID: | FBgn0033659 | Length: | 255 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_005157976.1 | Gene: | casp2 / 373118 | ZFINID: | ZDB-GENE-030825-3 | Length: | 437 | Species: | Danio rerio |
Alignment Length: | 266 | Identity: | 57/266 - (21%) |
---|---|---|---|
Similarity: | 104/266 - (39%) | Gaps: | 71/266 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 16 YDSNRVNAEP----GQGLDLNEKLKPPAVYILNHEQFPQ-DSQLN-RKGSSNDVNALRKTFESLK 74
Fly 75 CRVEVISNPALPDVKNKVKEWSAKRFTQDAGF---VLFILSHGDRKEKILACDHREYHLDDDVLF 136
Fly 137 PLFRN---PTLSGKPKILIVQACKGPL------RADAKKMNNEP--------------------- 171
Fly 172 ---------------YIKCYSCSEGY--LSYRNENHGSVFIQTLCEAMDQYGLTRDFQSIFKHVK 219
Fly 220 AEVERR 225 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Damm | NP_001303345.1 | Peptidase_C14 | 42..248 | CDD:279049 | 49/236 (21%) |
casp2 | XP_005157976.1 | CARD_CASP2 | 7..94 | CDD:260040 | |
CASc | 158..430 | CDD:237997 | 54/259 (21%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3573 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |