DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Damm and casp2

DIOPT Version :9

Sequence 1:NP_001303345.1 Gene:Damm / 36266 FlyBaseID:FBgn0033659 Length:255 Species:Drosophila melanogaster
Sequence 2:XP_005157976.1 Gene:casp2 / 373118 ZFINID:ZDB-GENE-030825-3 Length:437 Species:Danio rerio


Alignment Length:266 Identity:57/266 - (21%)
Similarity:104/266 - (39%) Gaps:71/266 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 YDSNRVNAEP----GQGLDLNEKLKPPAVYILNHEQFPQ-DSQLN-RKGSSNDVNALRKTFESLK 74
            |.|:|..|.|    .:||.|          :|::.:|.. ::.|: |:|...|...||:.|..|.
Zfish   151 YQSHRPQAYPMRSCPRGLAL----------VLSNVRFDSANTDLDIRRGGEVDEETLRRLFTELD 205

  Fly    75 CRVEVISNPALPDVKNKVKEWSAKRFTQDAGF---VLFILSHGDRKEKILACDHREYHLDDDVLF 136
            .:|.:..:.....::..:::::.::  :.|.:   |:.:|||| .:..:...|.:...|  |.:|
Zfish   206 FKVSLHRDLTAEAMRRCLEQFAQQQ--EHAAYDCAVVCLLSHG-VEGSVYGTDGQLLEL--DWVF 265

  Fly   137 PLFRN---PTLSGKPKILIVQACKGPL------RADAKKMNNEP--------------------- 171
            .:|.|   |.|..|||:..:|||:|..      :.|.::....|                     
Zfish   266 EVFDNARCPLLQNKPKMFFIQACRGEEMDNGVDQLDGQERTQSPGCEQRDAGREGERDNREKKEE 330

  Fly   172 ---------------YIKCYSCSEGY--LSYRNENHGSVFIQTLCEAMDQYGLTRDFQSIFKHVK 219
                           .|..::..:|:  .:.||...||.|||.|..|:.|.........|...|.
Zfish   331 KERERLRVKLPQRSDMICGFATLKGFSTAAMRNTKKGSWFIQELNTAIRQRANNTHLSDILVQVN 395

  Fly   220 AEVERR 225
            .:::.|
Zfish   396 GQIKSR 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DammNP_001303345.1 Peptidase_C14 42..248 CDD:279049 49/236 (21%)
casp2XP_005157976.1 CARD_CASP2 7..94 CDD:260040
CASc 158..430 CDD:237997 54/259 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.