DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Damm and cflara

DIOPT Version :9

Sequence 1:NP_001303345.1 Gene:Damm / 36266 FlyBaseID:FBgn0033659 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001300701.1 Gene:cflara / 373114 ZFINID:ZDB-GENE-030826-3 Length:461 Species:Danio rerio


Alignment Length:251 Identity:57/251 - (22%)
Similarity:93/251 - (37%) Gaps:50/251 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 KLKPPAVYILNHEQFPQDSQLN--RKG-------SSNDVNALRKTFESLKCRVEVISNPALPDVK 89
            ||..|...|...:...::.|:|  ::|       ...|...|:.|||.|..:|...|...|.:.:
Zfish   223 KLSVPETGIHYQQAITEEYQMNPEQRGLCVIIDCVGYDGEMLKHTFECLGFKVVFHSLLGLKETQ 287

  Fly    90 NKVKEWSAKRFTQDAG-FVLFILSHGDRKEKILACDHREYHLDDDVLFPLFRNPTLSGKPKILIV 153
            ..:::.|..|..|... ||..::|.|.... :||.|.....::...|..|| |.|..  |||...
Zfish   288 KVLEDLSLNRILQRVRCFVCCLISRGTNTH-LLATDSNRLGINLKDLKQLF-NATKC--PKIFFT 348

  Fly   154 QACKGPLRADAKKMNNEPYIKCYSCSEGYLSYRNENHGSV-----FIQTLCEA----MDQYGLTR 209
            |..:.........|::|     |..::...|.:..|.|||     .:.::|.|    :::.|   
Zfish   349 QLYRITEAPVMPSMDDE-----YLETDAPASRQCSNTGSVPMPADVLWSVCTAEVKLLEESG--- 405

  Fly   210 DFQSIFKH------------------VKAEVERRSTMTGSKQVPSEESHNFDKPFY 247
             .||::.:                  |..||:|......|.....::||...|..|
Zfish   406 -HQSVYLNALNNALLKGHERNVPILDVMKEVQRNVLSHDSDNYQLQQSHTLQKKLY 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DammNP_001303345.1 Peptidase_C14 42..248 CDD:279049 54/243 (22%)
cflaraNP_001300701.1 DED 8..87 CDD:307481
DED_c-FLIP_r2 100..180 CDD:260046
CASc 241..461 CDD:320727 53/233 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.