DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Damm and caspb

DIOPT Version :9

Sequence 1:NP_001303345.1 Gene:Damm / 36266 FlyBaseID:FBgn0033659 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_690840.2 Gene:caspb / 259303 ZFINID:ZDB-GENE-020812-1 Length:404 Species:Danio rerio


Alignment Length:231 Identity:61/231 - (26%)
Similarity:100/231 - (43%) Gaps:34/231 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 ILNHEQFPQDSQLNRKGSSNDVNALRKTFESLKCRVEVISNPALPDVKNKVKEWSAKRFTQDAG- 105
            ::.:.|| .::|.||.|:..|.........||...|....|.:..|::..|:.:|.:|..:||. 
Zfish   178 LITNIQF-ANTQHNRNGADRDEENAEWLLRSLGFAVIKYRNLSGKDIRRAVENFSKRREHEDADS 241

  Fly   106 -FVLFILSHG---DRKEKILACDHREYHLDDDVLF--PLFRN------PTLSGKPKILIVQACKG 158
             |:: |:|||   |.|:.|:.       :.|||.|  ..|.:      |.|..|||::::|||:|
Zfish   242 TFIV-IMSHGTRIDNKDAIVG-------VSDDVYFIEETFSHLNSVNCPALIDKPKVILIQACRG 298

  Fly   159 ----------PLRADAKKMNNEPYIKCY-SCSEGYLSYRNENHGSVFIQTLCEAMDQYGLTRDFQ 212
                      .:.|....::.|....|: |......:|||...||.||..:.:.........|..
Zfish   299 GQSSGVLAQDSVFASDSWVHMEKDFVCFMSTMPNTFAYRNPIEGSFFISYIVDVFCSSAHRDDIM 363

  Fly   213 SIFKHVKAEVERRSTMTG-SKQVPSEESHNFDKPFY 247
            .:|:.|...:|:.....| :|.:|..|..:..|.||
Zfish   364 ELFRKVTLRMEKDQRFQGQAKLLPCIERTSISKRFY 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DammNP_001303345.1 Peptidase_C14 42..248 CDD:279049 61/231 (26%)
caspbNP_690840.2 Pyrin_ASC-like 5..84 CDD:260033
CASc 163..401 CDD:237997 61/231 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.