DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Damm and Casp3

DIOPT Version :9

Sequence 1:NP_001303345.1 Gene:Damm / 36266 FlyBaseID:FBgn0033659 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_037054.1 Gene:Casp3 / 25402 RGDID:2275 Length:277 Species:Rattus norvegicus


Alignment Length:284 Identity:76/284 - (26%)
Similarity:120/284 - (42%) Gaps:61/284 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 ERLYDSNRVN------------AEPGQGLDLNEKLKPPAV---YILNHEQFPQDSQLN-RKGSSN 61
            |...||..:|            .:.|..||.:.|:..|.:   .|:|::.|.:.:.:: |.|:..
  Rat     5 ETSVDSKSINNFETKTIHGSKSMDSGIYLDSSYKMDYPEMGLCIIINNKNFHKSTGMSARNGTDV 69

  Fly    62 DVNALRKTFESLKCRVEVISNPALPDVKNKVKEWSAKRFTQDAGFVLFILSHGDRKEKILACDHR 126
            |...||:||.:||..|...::....::...:...|.:..::.:.||..||||||  |.::...:.
  Rat    70 DAANLRETFMALKYEVRNKNDLTREEIMELMDSVSKEDHSKRSSFVCVILSHGD--EGVIFGTNG 132

  Fly   127 EYHLDDDVLFPLFRNP---TLSGKPKILIVQACKG----------------------PLRADAKK 166
            .  :|...|...||..   :|:||||:.|:|||:|                      |:.||   
  Rat   133 P--VDLKKLTSFFRGDYCRSLTGKPKLFIIQACRGTELDCGIETDSGTDDDMACQKIPVEAD--- 192

  Fly   167 MNNEPYIKCYSCSEGYLSYRNENHGSVFIQTLCEAMDQYGLTRDFQSIFKHVKAEVERR------ 225
                 ::..||.:.||.|:||...||.|||:||..:..|....:|..|...|..:|...      
  Rat   193 -----FLYAYSTAPGYYSWRNSRDGSWFIQSLCAMLKLYAHKLEFMHILTRVNRKVATEFESFSL 252

  Fly   226 -STMTGSKQVPSEESHNFDKPFYF 248
             :|....||:|...| ...|..||
  Rat   253 DATFHAKKQIPCIVS-MLTKELYF 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DammNP_001303345.1 Peptidase_C14 42..248 CDD:279049 65/238 (27%)
Casp3NP_037054.1 CASc 37..277 CDD:214521 69/252 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
43.770

Return to query results.
Submit another query.