DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Damm and csp-3

DIOPT Version :9

Sequence 1:NP_001303345.1 Gene:Damm / 36266 FlyBaseID:FBgn0033659 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_493011.2 Gene:csp-3 / 190006 WormBaseID:WBGene00000821 Length:139 Species:Caenorhabditis elegans


Alignment Length:153 Identity:29/153 - (18%)
Similarity:53/153 - (34%) Gaps:27/153 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 FTQDAGFVLFILSHGDRKEKILACDHREYHLDDDVLFPLFRNPTLSGKPKILIVQACKGPLRADA 164
            |.:..||..|:       ::.:.||....:..|.:             ||..  |..|....:..
 Worm     3 FGKLGGFAFFL-------QRAVRCDGFIDNFFDRI-------------PKFF--QFMKSKFPSHQ 45

  Fly   165 KKMNNEPYIKCYSCSEGYLSYRNENHGSVFIQTLCEAMDQYGLTRDFQSIF----KHVKAEVERR 225
            ...:....:..:|.|.|:||:::|...:.:||.|...:.:.........:.    :.|..:.|..
 Worm    46 TSSSQADLLVSFSTSPGFLSFKDETKDTWYIQELYRVIIENAKDTHLADLLTETNRRVVEKYEAD 110

  Fly   226 STMTGSKQVPSEESHNFDKPFYF 248
            ..:...||.| |....|.|..:|
 Worm   111 KVVFVCKQAP-EFWSRFTKQLFF 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DammNP_001303345.1 Peptidase_C14 42..248 CDD:279049 28/151 (19%)
csp-3NP_493011.2 CASc <11..132 CDD:320727 25/143 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.