DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Damm and ZK795.2

DIOPT Version :9

Sequence 1:NP_001303345.1 Gene:Damm / 36266 FlyBaseID:FBgn0033659 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_502403.2 Gene:ZK795.2 / 178206 WormBaseID:WBGene00014082 Length:292 Species:Caenorhabditis elegans


Alignment Length:258 Identity:59/258 - (22%)
Similarity:86/258 - (33%) Gaps:101/258 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 GSSNDVNALRKTFESLKCRVEVISNPALPDVKNKVKEWSAKRFTQDAG----------------- 105
            |...|| |.:||.:.:          ||...|::||  |.:.|..:.|                 
 Worm    35 GKDTDV-AWQKTIDGI----------ALYIAKHQVK--SPQIFVHENGSICEFIGGVDRSKMRAD 86

  Fly   106 FVLFILSHGDRKEKILACDH------------REY----HLDDDVLFP---LFR-NPTLSGKPKI 150
            |:|.|..|..:|   |.||.            .:|    ..|:|:.|.   :|. :.|.|.|||.
 Worm    87 FILVIKKHTSQK---LKCDPEWGRQSFGVLNIEKYPTLSQTDEDLAFTAKIIFNSSETGSAKPKT 148

  Fly   151 L--IVQACK-------GPL---------RADAKKMNNEPYIKCY-------SCS------EGYLS 184
            :  :.|..|       .||         .|:.::..|...:|..       .||      .|.||
 Worm   149 VKSMDQLIKILEPKFMAPLSRIPDEYPETAEREEKRNRRILKAIIALMGLALCSLLVIMFMGSLS 213

  Fly   185 YRNENHGSVFIQTLCEAMDQYGLTRDFQSIFKHVKAEVERRSTM--TGSKQVPSEESHNFDKP 245
            ..|            ||..|..|.::.|...:...||...::..  ...|.|.||:|   :||
 Worm   214 RYN------------EAKKQKELEQEKQKKHEQKTAEKSEKAVKPEASEKSVKSEKS---EKP 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DammNP_001303345.1 Peptidase_C14 42..248 CDD:279049 59/258 (23%)
ZK795.2NP_502403.2 DUF1510 180..>263 CDD:284770 22/97 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.