DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Damm and csp-2

DIOPT Version :9

Sequence 1:NP_001303345.1 Gene:Damm / 36266 FlyBaseID:FBgn0033659 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001370851.1 Gene:csp-2 / 177391 WormBaseID:WBGene00000820 Length:826 Species:Caenorhabditis elegans


Alignment Length:292 Identity:64/292 - (21%)
Similarity:107/292 - (36%) Gaps:75/292 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MYLPERTEHQKIE--RLYDSNRVNAEPGQGLDLNEKLKPPAVYILNHEQFPQDSQLNRKGSSNDV 63
            |...:.::.:||:  |.|.:||           :.|.:   ..|:|:..|  .....|.||..|.
 Worm   564 MMCEDASDGKKIDETRKYRNNR-----------SSKCR---AIIINNVVF--CGMEKRIGSDKDK 612

  Fly    64 NALRKTFESLKCRVEVISNPALPDVKNKVKEWSAKRFTQD---AGFVLFILSHGDRKEKILACDH 125
            ..|.|.||.|..:.....|....::...|::     |||.   ...::.|:||||  :.:|    
 Worm   613 KKLSKLFERLGYQSTSYDNLKSSEILETVRQ-----FTQSNHGDSLIITIMSHGD--QGLL---- 666

  Fly   126 REYHLDD------DVLFPLFRNPTLSGKPKILIVQACKG-----PLRADA--------------- 164
              |.:|.      |:: .|....:|:.|||.|:...|:|     .:|.|.               
 Worm   667 --YGVDGVPVQMLDII-DLMCTASLAKKPKWLMCVCCRGDRIDRAVRCDGFIDNFFDRFPKFFQF 728

  Fly   165 ---------KKMNNEPYIKCYSCSEGYLSYRNENHGSVFIQTLCEAMDQYGLTRDFQSIF----K 216
                     ...:....:..:|.|.|:||:|:|..|:.:||.|...:.:.........:.    :
 Worm   729 MKSKFPSHQTSSSQADLLVSFSTSPGFLSFRDETKGTWYIQELYRVIIENAKDTHLADLLMETNR 793

  Fly   217 HVKAEVERRSTMTGSKQVPSEESHNFDKPFYF 248
            .|..:.|....:...||.| |....|.|..:|
 Worm   794 RVVEKYEADKVVIVCKQAP-EFWSRFTKQLFF 824

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DammNP_001303345.1 Peptidase_C14 42..248 CDD:279049 55/247 (22%)
csp-2NP_001370851.1 pneumo_PspA 239..>533 CDD:411490
PHA03418 <475..>563 CDD:177646
CASc 581..824 CDD:237997 59/273 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.770

Return to query results.
Submit another query.