DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Damm and Casp12

DIOPT Version :9

Sequence 1:NP_001303345.1 Gene:Damm / 36266 FlyBaseID:FBgn0033659 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_569106.1 Gene:Casp12 / 156117 RGDID:621758 Length:420 Species:Rattus norvegicus


Alignment Length:247 Identity:62/247 - (25%)
Similarity:111/247 - (44%) Gaps:45/247 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 ILNHEQFPQDSQLNRKGSSNDVNALRKTFESLKCRVEVISNPALPDVKNKVKEWSAK--RFTQDA 104
            |:.:::|  |...:|..:..|:..:::..::|...|.:..|....:::.::.:::.:  ..:.|:
  Rat   181 IICNKKF--DYLFDRDDAETDILNMKELLQNLGYSVVIKENLTAQEMETELMKFAGRPEHQSSDS 243

  Fly   105 GFVLFILSHGDRKEKILACDHREYH---LDDDVLFPLFRN---PTLSGKPKILIVQAC------- 156
            .|::| :||| ..|.|....||...   |.||.:|.:|.|   |:|..||||||:|||       
  Rat   244 TFLVF-MSHG-ILEGICGVKHRNKKPDVLHDDTIFTIFNNSNCPSLRNKPKILIMQACRGRHTGT 306

  Fly   157 ------KGPLRAD-------AKKMNNE--------PYIKCYSCSEGYLSYRNENHGSVFIQTLCE 200
                  ||...||       :.:.||.        .:|...|.:...:|::....||:||..|.:
  Rat   307 IWVSTSKGIATADTDEECVLSHRWNNSITKAHVETDFIAFKSSTPHNISWKVGKSGSLFISKLID 371

  Fly   201 AMDQYGLTRDFQSIFKHVKAEVERRSTMTGSKQVPSEESHNFDKPFYF--GN 250
            ...:|......:.||:.|:...|....:|   |:|:.|..:..:.||.  ||
  Rat   372 CFKKYCWCYHLEEIFRKVQYSFEVPGELT---QMPTIERVSMTRYFYLFPGN 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DammNP_001303345.1 Peptidase_C14 42..248 CDD:279049 59/241 (24%)
Casp12NP_569106.1 CARD_CASP1-like 6..88 CDD:260036
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 93..115
CASc 167..418 CDD:214521 60/243 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.