DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Damm and casp3a

DIOPT Version :9

Sequence 1:NP_001303345.1 Gene:Damm / 36266 FlyBaseID:FBgn0033659 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_571952.1 Gene:casp3a / 140621 ZFINID:ZDB-GENE-011210-1 Length:282 Species:Danio rerio


Alignment Length:283 Identity:76/283 - (26%)
Similarity:116/283 - (40%) Gaps:68/283 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 DSNRVNAEPGQGLDLNEK---------LKPPAV---YILNHEQFPQDSQLN-RKGSSNDVNALRK 68
            |:::..|...|.:.::.|         |..|.:   .|:|::.|.:.:.:| |.|:..|...:..
Zfish    15 DASKDGASASQPMQVDAKPQSHAFRYSLNYPNIGHCIIINNKNFDRRTGMNPRNGTDVDAGNVMN 79

  Fly    69 TFESLKCRVEVISNPALPDVKNKVKEWSAKRFTQDAGFVLFILSHGDRKEKILACDHREYHLDDD 133
            .|..|...|:|.::..:..:...:...:....::.|..|..:|||||  |.:.      :..|..
Zfish    80 VFRKLGYIVKVYNDQTVAQIMQVLTTVAHDDHSRCASLVCVLLSHGD--EGVF------FGTDTS 136

  Fly   134 V----LFPLFRN---PTLSGKPKILIVQACKG------------------------PLRADAKKM 167
            |    |..|||.   |:|.||||:..:|||:|                        |:.||    
Zfish   137 VDLKSLTSLFRGDRCPSLVGKPKLFFIQACRGTELDPGVETDHTDHPDIPDGRERIPVEAD---- 197

  Fly   168 NNEPYIKCYSCSEGYLSYRNENHGSVFIQTLCEAMDQYGLTRDFQSIFKHVKAEV----ERRSTM 228
                ::..||...||.|:||...||.|||:|||.|.:||...:...|...|..:|    |..|.|
Zfish   198 ----FLYAYSTVPGYYSWRNTMTGSWFIQSLCEMMTKYGSELELLQIMTRVNHKVALDFESTSNM 258

  Fly   229 TG---SKQVPSEESHNFDKPFYF 248
            .|   .||:|...| ...|..||
Zfish   259 PGFDAKKQIPCIVS-MLTKEMYF 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DammNP_001303345.1 Peptidase_C14 42..248 CDD:279049 68/244 (28%)
casp3aNP_571952.1 CASc 39..280 CDD:237997 70/257 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
32.770

Return to query results.
Submit another query.