DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Damm and Cflar

DIOPT Version :9

Sequence 1:NP_001303345.1 Gene:Damm / 36266 FlyBaseID:FBgn0033659 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001276633.1 Gene:Cflar / 12633 MGIID:1336166 Length:481 Species:Mus musculus


Alignment Length:206 Identity:43/206 - (20%)
Similarity:79/206 - (38%) Gaps:40/206 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 NDVNALRKTFESLKCRVEVISNPALPDVKNKVKEWSAKRFTQD-AGFVLFILSHG--------DR 116
            ||...|::||.||...:::...|...|:...|:.:::....|| ..|...::|.|        |:
Mouse   264 NDTKYLQETFTSLGYHIQLFLFPKSHDITQIVRRYASMAQHQDYDSFACVLVSLGGSQSMMGRDQ 328

  Fly   117 KEKILACDHREYHLDDDVLFPLFRNPTLSGKPKILIVQACK--GPLRADAKKMNNEPYIK----- 174
            .....:.||.:.....|..      |:|.||||:..:|..:  |....|:....:.|.||     
Mouse   329 VHSGFSLDHVKNMFTGDTC------PSLRGKPKLFFIQNYESLGSQLEDSSLEVDGPSIKNVDSK 387

  Fly   175 ------CYSCSEGYLSY-----------RNENHGSVFIQTLCEAMDQYGLTRDFQSIFKHVKAEV 222
                  |.:..|..:.:           :..:..||::|.|.:.:.| |..|....:...:..:|
Mouse   388 PLQPRHCTTHPEADIFWSLCTADVSHLEKPSSSSSVYLQKLSQQLKQ-GRRRPLVDLHVELMDKV 451

  Fly   223 ERRSTMTGSKQ 233
            ...::...||:
Mouse   452 YAWNSGVSSKE 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DammNP_001303345.1 Peptidase_C14 42..248 CDD:279049 43/206 (21%)
CflarNP_001276633.1 Interaction with CASP8 propeptide. /evidence=ECO:0000250|UniProtKB:O15519 6..307 11/42 (26%)
Interaction with FADD. /evidence=ECO:0000250|UniProtKB:O15519 6..229
Interaction with CASP8. /evidence=ECO:0000250|UniProtKB:O15519 6..200
DED_c-FLIP_r1 6..85 CDD:260044
DED_c-FLIP_r2 96..176 CDD:260046
Interaction with TRAF1 and TRAF2. /evidence=ECO:0000250|UniProtKB:O15519 197..481 43/206 (21%)
Interaction with CASP3. /evidence=ECO:0000250|UniProtKB:O15519 197..436 38/178 (21%)
Interaction with CASP8 subunits p18 and p10. /evidence=ECO:0000250|UniProtKB:O15519 219..481 43/206 (21%)
CASc 246..480 CDD:214521 43/206 (21%)
Caspase 265..360 24/100 (24%)
Interaction with CASP8. /evidence=ECO:0000250|UniProtKB:O15519 372..481 15/92 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.