DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Damm and Casp8

DIOPT Version :9

Sequence 1:NP_001303345.1 Gene:Damm / 36266 FlyBaseID:FBgn0033659 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001264855.1 Gene:Casp8 / 12370 MGIID:1261423 Length:500 Species:Mus musculus


Alignment Length:291 Identity:79/291 - (27%)
Similarity:124/291 - (42%) Gaps:71/291 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 KIERLYDSNRVNAEPGQGLDLNEKLK-PPAVY--ILNHEQFPQD----SQL----NRKGSSNDVN 64
            |:..|.||.|......:..|...::| .|..|  |:|:..|.:.    :||    :|||:..|..
Mouse   226 KMAELCDSPREQDSESRTSDKVYQMKNKPRGYCLIINNHDFSKAREDITQLRKMKDRKGTDCDKE 290

  Fly    65 ALRKTFESLKCRV------------EVISNPALPDVKNKVKEWSAKRFTQDAGFVLFILSHGDRK 117
            ||.|||:.|...:            |::......|.|||           |. |:..|||||| |
Mouse   291 ALSKTFKELHFEIVSYDDCTANEIHEILEGYQSADHKNK-----------DC-FICCILSHGD-K 342

  Fly   118 EKILACDHREYHLDD-DVLFPLFRNPTLSGKPKILIVQACKG-------PLRADAKKMNNEPYIK 174
            ..:...|.:|..:.| ...|...:.|:|||||||..:|||:|       |..|..::.|:...:.
Mouse   343 GVVYGTDGKEASIYDLTSYFTGSKCPSLSGKPKIFFIQACQGSNFQKGVPDEAGFEQQNHTLEVD 407

  Fly   175 CYSCSEGYL-----------------SYRNENHGSVFIQTLCEAM-DQYGLTRDFQSIFKHVKAE 221
            . |..:.|:                 |||:..:|:.:||:||::: ::.....|..||...|..:
Mouse   408 S-SSHKNYIPDEADFLLGMATVKNCVSYRDPVNGTWYIQSLCQSLRERCPQGDDILSILTGVNYD 471

  Fly   222 V----ERRSTMTGSKQVPSEESHNFDKPFYF 248
            |    :||:.   .||:| :.:....|..:|
Mouse   472 VSNKDDRRNK---GKQMP-QPTFTLRKKLFF 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DammNP_001303345.1 Peptidase_C14 42..248 CDD:279049 69/255 (27%)
Casp8NP_001264855.1 DED_Caspase_8_r1 23..104 CDD:260041
DD 118..199 CDD:387368
CASc 247..499 CDD:237997 73/270 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.