DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Damm and Casp6

DIOPT Version :9

Sequence 1:NP_001303345.1 Gene:Damm / 36266 FlyBaseID:FBgn0033659 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_033941.3 Gene:Casp6 / 12368 MGIID:1312921 Length:276 Species:Mus musculus


Alignment Length:278 Identity:77/278 - (27%)
Similarity:124/278 - (44%) Gaps:59/278 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 YDSNRVNAEPGQGLDLNEKLKPPAVYILNHEQF------PQDSQLNRKGSSNDVNALRKTFESLK 74
            |.|..| .:|.:...::.|.:..|: |.|||:|      |:     |:|::.|.:.|.:.|..|.
Mouse     8 YKSREV-FDPAEQYKMDHKRRGVAL-IFNHERFFWHLTLPE-----RRGTNADRDNLTRRFSDLG 65

  Fly    75 CRVEVISNPALPDVKNKVKEWSAKRFTQDAGFVLFILSHGDRKEKILACDHREYHLDDDVLFPLF 139
            ..|:..::....::..|:.|.|.........|:...||||:... :.|.|.:   ::...|..||
Mouse    66 FEVKCFNDLRAEELLLKIHEVSTSSHIDADCFICVFLSHGEGNH-VYAYDAK---IEIQTLTGLF 126

  Fly   140 RN---PTLSGKPKILIVQACKG--------PL--------------RADAKKMNNEP----YIKC 175
            :.   .:|.|||||.|:|||:|        ||              :.||..:...|    ::.|
Mouse   127 KGDKCQSLVGKPKIFIIQACRGSQHDVPVVPLDMVDHQTDKLDNVTQVDAASVYTLPAGADFLMC 191

  Fly   176 YSCSEGYLSYRNENHGSVFIQTLCEAMDQYGLTRDFQSIFKHVKAEVERRST-------MTGSKQ 233
            ||.:|||.|:|...:||.:||.|||.:.:||.:.:|..:...|..:|.:|..       ..|.||
Mouse   192 YSVAEGYYSHRETVNGSWYIQDLCEMLARYGSSLEFTELLTLVNRKVSQRRVDFCKDPDAIGKKQ 256

  Fly   234 VP------SEESHNFDKP 245
            ||      :::.|...||
Mouse   257 VPCFASMLTKKLHFCPKP 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DammNP_001303345.1 Peptidase_C14 42..248 CDD:279049 71/252 (28%)
Casp6NP_033941.3 CASc 20..272 CDD:214521 71/261 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.770

Return to query results.
Submit another query.