DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Damm and Casp4

DIOPT Version :9

Sequence 1:NP_001303345.1 Gene:Damm / 36266 FlyBaseID:FBgn0033659 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_031635.2 Gene:Casp4 / 12363 MGIID:107700 Length:373 Species:Mus musculus


Alignment Length:286 Identity:71/286 - (24%)
Similarity:120/286 - (41%) Gaps:58/286 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PE---RTEHQKIERLYDSNRVNAEPGQGLDLNEKLKPPAVYILNHEQFPQDSQLNRKGSSNDVNA 65
            ||   |...:|.:.:|.....|....:.|            |:.:.:|...|.  |.|::.|:..
Mouse   107 PEEFTRLCREKTQEIYPIKEANGRTRKAL------------IICNTEFKHLSL--RYGANFDIIG 157

  Fly    66 LRKTFESLKCRVEVISNPALPDVKNKVKEWSA--KRFTQDAGFVLFILSHGDRKEKILACDHREY 128
            ::...|.|...|.|........:::::|:::|  :..|.|:.| |.::||| ....|....|.|.
Mouse   158 MKGLLEDLGYDVVVKEELTAEGMESEMKDFAALSEHQTSDSTF-LVLMSHG-TLHGICGTMHSEK 220

  Fly   129 H---LDDDVLFPLFRN---PTLSGKPKILIVQACKG------------------------PLRAD 163
            .   |..|.::.:|.|   |.|..|||::|||||:|                        .:.||
Mouse   221 TPDVLQYDTIYQIFNNCHCPGLRDKPKVIIVQACRGGNSGEMWIRESSKPQLCRGVDLPRNMEAD 285

  Fly   164 AKKMNN--EPYIKCYSCSEGYLSYRNENHGSVFIQTLCEAMDQYGLTRDFQSIFKHVKAEVERRS 226
            |.|:::  :.:|..||.:..:||||::..||.||..|.....::..:.....||..|:...|:.|
Mouse   286 AVKLSHVEKDFIAFYSTTPHHLSYRDKTGGSYFITRLISCFRKHACSCHLFDIFLKVQQSFEKAS 350

  Fly   227 TMTGSKQVPSEESHNFDKPFYF--GN 250
            .   ..|:|:.:.....:.||.  ||
Mouse   351 I---HSQMPTIDRATLTRYFYLFPGN 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DammNP_001303345.1 Peptidase_C14 42..248 CDD:279049 61/239 (26%)
Casp4NP_031635.2 Required for LPS-binding. /evidence=ECO:0000269|PubMed:25119034 1..59
CARD_CASP1-like 5..85 CDD:260036
CASc 122..371 CDD:214521 65/267 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.