DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Damm and Casp1

DIOPT Version :9

Sequence 1:NP_001303345.1 Gene:Damm / 36266 FlyBaseID:FBgn0033659 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_033937.2 Gene:Casp1 / 12362 MGIID:96544 Length:402 Species:Mus musculus


Alignment Length:273 Identity:69/273 - (25%)
Similarity:122/273 - (44%) Gaps:48/273 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 QKIERLYDSNRVNAEPGQGLDLNEKLKPPAVYILNHEQFPQDSQLNRKGSSNDVNALRKTFESLK 74
            :|.::|:..|.....|........:|   |:.|.|.| |...|.  |.|:..|:..::...|.|.
Mouse   138 EKAQKLWKENPSEIYPIMNTTTRTRL---ALIICNTE-FQHLSP--RVGAQVDLREMKLLLEDLG 196

  Fly    75 CRVEVISNPALPDVKNKVKEWSA--KRFTQDAGFVLFILSHGDRKEKILACDHREYHLDD----D 133
            ..|:|..|....::..:|||::|  :..|.|:.|::| :||| .:|.|....:.. .:.|    |
Mouse   197 YTVKVKENLTALEMVKEVKEFAACPEHKTSDSTFLVF-MSHG-IQEGICGTTYSN-EVSDILKVD 258

  Fly   134 VLFPLFRN---PTLSGKPKILIVQACKGP-----LRADAKKMNNEPYIK---------------- 174
            .:|.:...   |:|..|||::|:|||:|.     |..|:.:.:.|.::.                
Mouse   259 TIFQMMNTLKCPSLKDKPKVIIIQACRGEKQGVVLLKDSVRDSEEDFLTDAIFEDDGIKKAHIEK 323

  Fly   175 -----CYSCSEGYLSYRNENHGSVFIQTLCEAMDQYGLTRDFQSIFKHVKAEVERRSTMTGSKQV 234
                 |.|..:. :|:|:...||:||::|.:.|.:|..:.|.:.||:.|:...|:.....   |:
Mouse   324 DFIAFCSSTPDN-VSWRHPVRGSLFIESLIKHMKEYAWSCDLEDIFRKVRFSFEQPEFRL---QM 384

  Fly   235 PSEESHNFDKPFY 247
            |:.:.....|.||
Mouse   385 PTADRVTLTKRFY 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DammNP_001303345.1 Peptidase_C14 42..248 CDD:279049 63/241 (26%)
Casp1NP_033937.2 CARD_CASP1-like 6..87 CDD:260036
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 98..125
CASc 152..400 CDD:214521 66/259 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.