DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Damm and CARD16

DIOPT Version :9

Sequence 1:NP_001303345.1 Gene:Damm / 36266 FlyBaseID:FBgn0033659 Length:255 Species:Drosophila melanogaster
Sequence 2:XP_011540885.1 Gene:CARD16 / 114769 HGNCID:33701 Length:265 Species:Homo sapiens


Alignment Length:211 Identity:42/211 - (19%)
Similarity:70/211 - (33%) Gaps:70/211 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 KP-PAVYILNHEQFPQDSQLNRK-----------GSSNDV-NALRKTF--------------ESL 73
            || |...:|..||.|...:|.:.           ||.:.| ...||.|              |.|
Human    34 KPWPVSLLLFQEQVPGKKELWKGLALLEAIISICGSLDKVLKEKRKLFIHSMGEGTINGLLDELL 98

  Fly    74 KCRVEVISNPALPDVKNKVKEWSAKRFTQDAGFVLFILSHGDRKEKI---LACDHREY------- 128
            :.||      ...:...|||..:|....:....:..::..|.:..:|   ..|:...|       
Human    99 QTRV------LNQEEMEKVKRENATVMDKTRALIDSVIPKGAQACQICITYICEEDSYLAETLGL 157

  Fly   129 -----HLDDDVLFPLFRNPTLSGKPKILIVQACKGPLRADAKKMNNEPYIKCY------SCSEGY 182
                 .:.|:...|...:|  .|:.|:..::        ||:::..:...:|:      ..||.|
Human   158 SAALQAVQDNPAMPTCSSP--EGRIKLCFLE--------DAQRIWKQKLQRCHVQNTIIKWSERY 212

  Fly   183 LSYRNENHGSVFIQTL 198
            .|      ||..:|.|
Human   213 TS------GSFEMQWL 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DammNP_001303345.1 Peptidase_C14 42..248 CDD:279049 39/204 (19%)
CARD16XP_011540885.1 CARD_CASP1-like 73..155 CDD:260036 16/87 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.