DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Damm and Casp4

DIOPT Version :9

Sequence 1:NP_001303345.1 Gene:Damm / 36266 FlyBaseID:FBgn0033659 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_446188.2 Gene:Casp4 / 114555 RGDID:621757 Length:373 Species:Rattus norvegicus


Alignment Length:277 Identity:67/277 - (24%)
Similarity:119/277 - (42%) Gaps:55/277 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 QKIERLYDSNRVNAEPGQGLDLNEKLKPPAVYILNHEQFPQDSQLNRKGSSNDVNALRKTFESLK 74
            :|.:.:|.....|....:.|            |:.:.:|...|.  |.|::.|::.::...|.|.
  Rat   116 EKKQEIYPIKETNGRTRKAL------------IICNTEFKHLSL--RYGANIDISGMKGLLEELG 166

  Fly    75 CRVEVISNPALPDVKNKVKEWSA--KRFTQDAGFVLFILSHGDRKEKILACDHREYHLD---DDV 134
            ..|.|........:::::|:::|  :..|.|:.| |.::||| ..:.:....|.|...|   .|.
  Rat   167 YDVVVKEELTAEGMESEMKDFAALSEHQTSDSTF-LVLMSHG-TLQGLCGTMHSEATPDVLLYDT 229

  Fly   135 LFPLFRN---PTLSGKPKILIVQACKG------------------------PLRADAKKMNN--E 170
            ::.:|.|   |.|..|||::|||||:|                        .:.|||.:|::  :
  Rat   230 IYQIFNNCHCPGLRDKPKVIIVQACRGGNPGEVWIRESSGAHSYRAVDLPRNMEADAVRMSHVEK 294

  Fly   171 PYIKCYSCSEGYLSYRNENHGSVFIQTLCEAMDQYGLTRDFQSIFKHVKAEVERRSTMTGSKQVP 235
            .:|..||.:..:||||::..||.||..|......:..:.....||..|:...|:.|.   :.|:|
  Rat   295 DFIALYSTTPHHLSYRDKTRGSYFISKLISCFRIHACSCHLFDIFLKVQQSFEKASI---NSQMP 356

  Fly   236 SEESHNFDKPFYF--GN 250
            :.:.....:.||.  ||
  Rat   357 TIDRATLTRYFYLFPGN 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DammNP_001303345.1 Peptidase_C14 42..248 CDD:279049 60/239 (25%)
Casp4NP_446188.2 CARD_CASP1-like 5..85 CDD:260036
CASc 122..371 CDD:214521 64/267 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.