DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Damm and casp2

DIOPT Version :9

Sequence 1:NP_001303345.1 Gene:Damm / 36266 FlyBaseID:FBgn0033659 Length:255 Species:Drosophila melanogaster
Sequence 2:XP_012809163.2 Gene:casp2 / 100486813 XenbaseID:XB-GENE-482390 Length:421 Species:Xenopus tropicalis


Alignment Length:266 Identity:64/266 - (24%)
Similarity:102/266 - (38%) Gaps:58/266 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 TEHQKIERLYDSNRVNAEPGQGLDLNEKLKPPAVYILNHEQFPQDSQLNRKGSSNDVNALRKTFE 71
            :.||:..:::...|     |:.|            |:::..|......:|.|...||.:|.|.|.
 Frog   156 SHHQQAYKMHSCPR-----GRAL------------IISNVAFETQDLDHRYGGEVDVASLEKLFS 203

  Fly    72 SLKCRVEVISNPALPDVKNKVKEWSA--KRFTQDAGFVLFILSHGDRKEKILACDHREYHLDDDV 134
            ||..:|||..|....::.:::..:||  .....|: .|:.:|||| ....:...|.:...|.|  
 Frog   204 SLGFQVEVRRNLNAQNMMSQLGAFSALPAHSALDS-CVVAVLSHG-LDGAVYGTDGKLVQLQD-- 264

  Fly   135 LFPLFRN---PTLSGKPKILIVQACKGPL------RADAKKMNNEP------------------- 171
            :|....|   |.|..|||:..:|||:|..      :.|.::.:..|                   
 Frog   265 VFTAMDNAHCPQLQNKPKMFFIQACRGEEADRGVDQRDGREQSASPGCEQSDAGREDIKVRLPTQ 329

  Fly   172 --YIKCYSCSEGYLSYRNENHGSVFIQTLCEAMDQYGLTRDFQSIFKHVKAEVERRSTMTGSKQV 234
              .|..|:|.:|.:|.||...||.|:|.|.....||........:...|.|.::.|     ....
 Frog   330 SDMICAYACLKGTVSLRNTKRGSWFVQDLVSVFSQYSKNTHVADMLVKVNALIKER-----EGHA 389

  Fly   235 PSEESH 240
            |..|.|
 Frog   390 PGTEFH 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DammNP_001303345.1 Peptidase_C14 42..248 CDD:279049 59/231 (26%)
casp2XP_012809163.2 DD 5..86 CDD:417479
CASc 161..414 CDD:237997 62/261 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.