DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Twdlbeta and TwdlT

DIOPT Version :9

Sequence 1:NP_610707.2 Gene:Twdlbeta / 36265 FlyBaseID:FBgn0033658 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_651999.1 Gene:TwdlT / 44790 FlyBaseID:FBgn0029170 Length:286 Species:Drosophila melanogaster


Alignment Length:159 Identity:68/159 - (42%)
Similarity:82/159 - (51%) Gaps:30/159 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 GPPAASEALVTKNVYVHVPPEEPEFYPASSPIQTAVPKKHYKIIFIKAPNPPTPVRQVLPPPVQD 125
            |.......||.|::||||||.|.|.......:.....:|||||||||||:||:....|:|...|:
  Fly   122 GGGGGGTTLVQKHIYVHVPPPEQEEVRQRPNLPIGQSQKHYKIIFIKAPSPPSYQAPVIPLQPQN 186

  Fly   126 EHKTLVYVLVKKPEEQQPVILPAPEPTEPSKPEVYFIKYKQQQAKPATQYG-------------- 176
            |.||||||||||||:||.:::|.|.||:||||||||||||.|:.......|              
  Fly   187 EEKTLVYVLVKKPEDQQDIVIPTPAPTQPSKPEVYFIKYKTQKDSSGISGGISGSTGGFTQTNTG 251

  Fly   177 ----------------PPPSAPSEEYGAP 189
                            ...||||..||.|
  Fly   252 NGYTSGGDGGFTGGDSGSISAPSSNYGPP 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlbetaNP_610707.2 DM5 68..167 CDD:214776 58/98 (59%)
TwdlTNP_651999.1 DUF243 132..225 CDD:281144 53/92 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AX5Q
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D626001at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.