DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Twdlbeta and TwdlT

DIOPT Version :10

Sequence 1:NP_610707.2 Gene:Twdlbeta / 36265 FlyBaseID:FBgn0033658 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_651999.1 Gene:TwdlT / 44790 FlyBaseID:FBgn0029170 Length:286 Species:Drosophila melanogaster


Alignment Length:48 Identity:11/48 - (22%)
Similarity:22/48 - (45%) Gaps:9/48 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   181 ATVT-----YDDASAAQSAIGWF-DNKEFNGAIVKVT---LAQRFSNW 219
            |.||     ::..:.:..|.|.| ....|:|...::|   ::..:|:|
  Fly    26 ANVTILSDRFEQDTCSDVAAGLFRPGTSFSGPTEEITRKWISDAYSHW 73

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlbetaNP_610707.2 DM5 68..167 CDD:214776
TwdlTNP_651999.1 DUF243 131..225 CDD:460806
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.