DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Twdlbeta and TwdlC

DIOPT Version :9

Sequence 1:NP_610707.2 Gene:Twdlbeta / 36265 FlyBaseID:FBgn0033658 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_651519.1 Gene:TwdlC / 43245 FlyBaseID:FBgn0039469 Length:360 Species:Drosophila melanogaster


Alignment Length:284 Identity:106/284 - (37%)
Similarity:140/284 - (49%) Gaps:95/284 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQTQCILLLLAASL-AICVARPEPPR--SRYG---------------PPPP----PAPQKE---- 39
            |:...:.::..||| |..:.|||||.  |.:|               |.||    |.||::    
  Fly     1 MRVSSLFVVCVASLVATTLGRPEPPSPYSYHGLPQQQSQRALPLNAHPVPPQIYQPLPQEQSFAN 65

  Fly    40 -------YGPP-------------APAAQPLPVYGPP------------AAFY--GPPAASEALV 70
                   |.||             |.||:||..|...            |:.|  ||   .|..|
  Fly    66 FAPPQQTYLPPQMHLDAIEQVAPTAAAAEPLNAYDDSYNMAHRLSGVQHASGYNNGP---QETKV 127

  Fly    71 TKNVYVHVPPEEPEFYPASSPIQTAV-----PK-KHYKIIFIKAPNPPTPVRQVLPPPVQDEHKT 129
            .|::||||||::   :.....|||.|     || |||||:|||||:.|...:.|:|||.|:|.||
  Fly   128 HKHIYVHVPPKD---FEEEDAIQTRVHHQQGPKQKHYKIVFIKAPSAPAIRQPVVPPPPQNEEKT 189

  Fly   130 LVYVLVKKPEEQQPVILPAPEPTEPSKPEVYFIKYKQQQAKPATQYGPPPS------APSEEYGA 188
            |:|||.||||::|.:::|.|.||:||||||||||||.::.: |..|||||:      |.:|:: |
  Fly   190 LIYVLHKKPEQEQDIVIPTPPPTKPSKPEVYFIKYKTKKDE-APVYGPPPAEMEPRQATAEDF-A 252

  Fly   189 P--------------PAPR-TVEQ 197
            |              |||. .|||
  Fly   253 PLAEVADVLPPTTLAPAPEPEVEQ 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlbetaNP_610707.2 DM5 68..167 CDD:214776 58/104 (56%)
TwdlCNP_651519.1 DUF243 125..227 CDD:299795 58/104 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AX5Q
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D626001at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.