DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Twdlbeta and TwdlS

DIOPT Version :9

Sequence 1:NP_610707.2 Gene:Twdlbeta / 36265 FlyBaseID:FBgn0033658 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_651491.1 Gene:TwdlS / 43209 FlyBaseID:FBgn0039443 Length:228 Species:Drosophila melanogaster


Alignment Length:148 Identity:35/148 - (23%)
Similarity:58/148 - (39%) Gaps:34/148 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 AAQPLPVYGPPA--------AFYG---------PPAASEA-----LVTKNVYVHVPPEEPEFYPA 88
            |..||||....|        .|.|         .||.:|.     |.|:......|||:.:..|.
  Fly     2 AKNPLPVRNIAAMLSLLLLWTFLGFCHGLGEVYLPAENEVSSGGKLATEYFTYAAPPEDDQVAPW 66

  Fly    89 SSPIQTA-VPKKHYKIIFIKAPNPPTPVRQVLPPPVQDEHKTLVYVLVKKPE-----EQQPVILP 147
            .|..:.| |.....:::||:.|.  |.:..:....:...:...::||.::.:     :||..|  
  Fly    67 QSARELAKVLSPPQQVVFIRTPE--TNIFTLTAKQLAVNNPLDIFVLHRQADADALAKQQAAI-- 127

  Fly   148 APEPTEPSKPEVYFIKYK 165
              :.....||.|:|:||:
  Fly   128 --QQQVSEKPSVHFVKYR 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlbetaNP_610707.2 DM5 68..167 CDD:214776 24/109 (22%)
TwdlSNP_651491.1 DM5 45..145 CDD:214776 24/105 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.