Sequence 1: | NP_610707.2 | Gene: | Twdlbeta / 36265 | FlyBaseID: | FBgn0033658 | Length: | 198 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_651489.2 | Gene: | TwdlJ / 43206 | FlyBaseID: | FBgn0039440 | Length: | 274 | Species: | Drosophila melanogaster |
Alignment Length: | 232 | Identity: | 55/232 - (23%) |
---|---|---|---|
Similarity: | 83/232 - (35%) | Gaps: | 69/232 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 20 RPEPPRSRYGPPPPPAPQKEYGP-PAPAAQPLPVYGPPAAFYGPPAASEALVTKNVYVHVPPEEP 83
Fly 84 EFY-PASSPIQTAVPKKHYKIIFIKAPNPPTPVRQVLPPPVQ-DEHKTLVYVLVKKPEEQQPVI- 145
Fly 146 -----LPAPEPTEPSKPEVYFIKYK---------------------QQQAK-------------- 170
Fly 171 ---------------PATQYGPPPSAPSEEYGAPPAP 192 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Twdlbeta | NP_610707.2 | DM5 | 68..167 | CDD:214776 | 29/127 (23%) |
TwdlJ | NP_651489.2 | DM5 | 85..186 | CDD:214776 | 29/106 (27%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR31927 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.010 |