DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Twdlbeta and TwdlK

DIOPT Version :9

Sequence 1:NP_610707.2 Gene:Twdlbeta / 36265 FlyBaseID:FBgn0033658 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_651488.1 Gene:TwdlK / 43205 FlyBaseID:FBgn0039439 Length:247 Species:Drosophila melanogaster


Alignment Length:199 Identity:54/199 - (27%)
Similarity:82/199 - (41%) Gaps:34/199 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 RPEPPRSRYGPPPPPAPQKEYGP-PAPAAQPLPVYGPPAAFYGPPAASEALVTKNVYVHVPPEEP 83
            :|....|...|...|||...:.| |:..|..|.  |..:|.....||.:|.:.|..:.:. .:|.
  Fly    35 QPSGSASSDAPAFAPAPSASFAPGPSSIADALE--GSQSAAAPNYAAPQAQLEKEFFTYT-ADEG 96

  Fly    84 EFY--PASSPIQTAVPKKHYKIIFIKAPNPPTPVRQVLPPPVQ-DEHKTLVYVLVKKPEEQQPVI 145
            :||  .||..:..|| .|..:::|||.|.........|....| .:.:|.:|||.|:.:     |
  Fly    97 DFYDPSASDRVANAV-NKGLRVVFIKGPENSGLEDAALALAKQAAQQETAIYVLNKQAD-----I 155

  Fly   146 ------LPAPEPTEPSKPEVYFIKYK------QQQAKPATQY----GPPPS-----APSEEYGAP 189
                  |.:......:||||:|:||:      ..|:....||    |...|     |.:..:.:.
  Fly   156 GDLANKLNSIRNNNNNKPEVHFVKYRTPEDAANAQSAIQGQYDQLGGSSQSQNGGVASTLNFASQ 220

  Fly   190 PAPR 193
            ||||
  Fly   221 PAPR 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlbetaNP_610707.2 DM5 68..167 CDD:214776 30/113 (27%)
TwdlKNP_651488.1 DM5 82..183 CDD:214776 30/107 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.