DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Twdlbeta and TwdlB

DIOPT Version :9

Sequence 1:NP_610707.2 Gene:Twdlbeta / 36265 FlyBaseID:FBgn0033658 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_651486.1 Gene:TwdlB / 43202 FlyBaseID:FBgn0039436 Length:286 Species:Drosophila melanogaster


Alignment Length:131 Identity:31/131 - (23%)
Similarity:49/131 - (37%) Gaps:29/131 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 YGPPAPAAQPLPVYGPPAAFYGPPAASEALVTKNVYVHVPPEEPEFYPASSPIQTAVPKKHYKII 104
            |..|||||:                     :.|..:.:...|:....|...........|..:::
  Fly   115 YNAPAPAAE---------------------LQKEFFTYSANEQDFDEPQELERVAGSVNKGLRVV 158

  Fly   105 FIKAPNPPTPVRQVLPPPVQ-DEHKTLVYVLVKKPE----EQQPVILPAPEPTEPSKPEVYFIKY 164
            |||.|.........|....| .:.:|.:|||.|:.:    .|:   |.|......:||||:|:||
  Fly   159 FIKGPENRGLENAALALAKQAAQQETAIYVLNKQADIGDLAQK---LNAIRNNNNNKPEVHFVKY 220

  Fly   165 K 165
            :
  Fly   221 R 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlbetaNP_610707.2 DM5 68..167 CDD:214776 25/103 (24%)
TwdlBNP_651486.1 DM5 122..223 CDD:214776 26/124 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.