DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Twdlbeta and TwdlP

DIOPT Version :9

Sequence 1:NP_610707.2 Gene:Twdlbeta / 36265 FlyBaseID:FBgn0033658 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_651485.1 Gene:TwdlP / 43201 FlyBaseID:FBgn0039435 Length:220 Species:Drosophila melanogaster


Alignment Length:225 Identity:55/225 - (24%)
Similarity:86/225 - (38%) Gaps:50/225 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQTQCILLLLAASLAICVARPEPPRSRYGPPPPPAPQKEYGPPAPAA------QPLPVYGPPAAF 59
            |:...||.::||:.|..:       |.|          .||..|..:      .|:|....|.::
  Fly     1 MRALIILSIVAAASAGSL-------SGY----------NYGQGATTSIGGSGVSPVPALAGPVSY 48

  Fly    60 YGPPAASEALVTKNVYVHVPPEEPEFYPASSPIQTAVP--KKHYKIIFIKAPNPPTPVRQVLPPP 122
            ...|.||   |.|..|.....::.  :...:.:|.|:.  ||:.::||||:|........||...
  Fly    49 SAAPQAS---VHKEFYSFYANDDD--FEDKAALQRALASVKKNIRVIFIKSPENRGYENAVLALA 108

  Fly   123 VQ-DEHKTLVYVLVKKPE-EQQPVILPAPEPTEPSKPEVYFIKYK------QQQAKPATQY---- 175
            .| .:.:|.:|||.|:.: .:......|.......||||:|:||:      ..|....:||    
  Fly   109 KQAAQQQTAIYVLHKQTDINELAQKFNAVRQNANKKPEVHFVKYRTPEDAANAQRAIQSQYDQLG 173

  Fly   176 --------GPPPSAPSEEYGAPPAPRTVEQ 197
                    |...:......||.||..|.:|
  Fly   174 GSSQSINGGVANAINFASQGAAPARVTPQQ 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlbetaNP_610707.2 DM5 68..167 CDD:214776 28/108 (26%)
TwdlPNP_651485.1 DUF243 57..152 CDD:281144 25/96 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.