DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Twdlbeta and TwdlM

DIOPT Version :10

Sequence 1:NP_610707.2 Gene:Twdlbeta / 36265 FlyBaseID:FBgn0033658 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_651484.1 Gene:TwdlM / 43200 FlyBaseID:FBgn0039434 Length:288 Species:Drosophila melanogaster


Alignment Length:133 Identity:30/133 - (22%)
Similarity:48/133 - (36%) Gaps:33/133 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 YGPPAPAAQPLPVYGPPAAFYGPPAASEALVTKNVYVHVPPEEPEFYPASSPIQTAVPKKHYKII 104
            |..|||.|:                     :.|..:.....|:....|......::...|..:::
  Fly   119 YNAPAPTAE---------------------LEKEFFTFTANEQDFDEPQQLERVSSALNKALRVV 162

  Fly   105 FIKAPNPPTPVRQVLPPPVQ-DEHKTLVYVLVKKPEEQQPVI------LPAPEPTEPSKPEVYFI 162
            |||.|.........|....| .:.:|.:|||.|:.:     |      |.|......:||||:|:
  Fly   163 FIKGPENRGLENAALALAKQAAQQETAIYVLNKQAD-----IGDLANKLNAIRSNNNNKPEVHFV 222

  Fly   163 KYK 165
            ||:
  Fly   223 KYR 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlbetaNP_610707.2 DM5 68..167 CDD:214776 25/105 (24%)
TwdlMNP_651484.1 DUF243 130..224 CDD:460806 23/98 (23%)

Return to query results.
Submit another query.