DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Twdlbeta and TwdlF

DIOPT Version :9

Sequence 1:NP_610707.2 Gene:Twdlbeta / 36265 FlyBaseID:FBgn0033658 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_649443.1 Gene:TwdlF / 40534 FlyBaseID:FBgn0037224 Length:354 Species:Drosophila melanogaster


Alignment Length:241 Identity:71/241 - (29%)
Similarity:95/241 - (39%) Gaps:71/241 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 CILLLLAA------------SLAICVARPEPPRSRYG----PPPPPAPQKEYGP----------- 42
            |::.|.|.            :|.|...||..|.|..|    ...|..||....|           
  Fly     9 CLVALTATAPQGYKYQPQLPALPIGNLRPLTPISSSGIYASGAVPSFPQAGAQPAIGVQPAIQAV 73

  Fly    43 --------PAPAAQPLPVYGPPAAF-----------------------YGPPAASE-------AL 69
                    ||||..||.:..|...|                       ..|..|.:       |:
  Fly    74 QTIVAAPAPAPAPAPLSISLPKETFLTASPQQNLISTVQQQPQQIVYQQQPQQALQTQFVQRPAI 138

  Fly    70 VTKNVYVHVPPEEPEFYPASSPIQTAVP-KKHYKIIFIKAPNPPTPVRQVLPPPVQ--DEHKTLV 131
            |||::|:|..|||.|......|:...|| :|:|:|:|||||:.............|  :|.||::
  Fly   139 VTKDIYIHSAPEENEELRQDEPLLENVPIRKNYRIVFIKAPSQNLKYTAAALKRAQSSNEEKTVI 203

  Fly   132 YVLVKKPE--EQQPVILPAPEPTEPSKPEVYFIKYK-QQQAKPATQ 174
            |||.|||:  |.|..:.......:..|||||||||| |::|:.|.|
  Fly   204 YVLSKKPDLTEIQQQLQVTQSEAKVQKPEVYFIKYKTQEEAQRAQQ 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlbetaNP_610707.2 DM5 68..167 CDD:214776 43/104 (41%)
TwdlFNP_649443.1 DM5 137..241 CDD:214776 43/103 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.