| Sequence 1: | NP_610707.2 | Gene: | Twdlbeta / 36265 | FlyBaseID: | FBgn0033658 | Length: | 198 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_733161.2 | Gene: | TwdlR / 318586 | FlyBaseID: | FBgn0051081 | Length: | 325 | Species: | Drosophila melanogaster |
| Alignment Length: | 198 | Identity: | 53/198 - (26%) |
|---|---|---|---|
| Similarity: | 79/198 - (39%) | Gaps: | 62/198 - (31%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 53 YGPPAAFYGPPAASEALVTKNVYVHVPPE---------EPEFYPASSPIQ------------TAV 96
Fly 97 PKKHYKIIFIKAPNPPTPVRQVLPPPVQ-DEHKTLVYVLVKKPEEQQPVI-LPAPEPTEPSKPEV 159
Fly 160 YFIKYK-QQQAKPA-----TQYG-----PPP------------------SAPSEEY-----GAPP 190
Fly 191 APR 193 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Twdlbeta | NP_610707.2 | DM5 | 68..167 | CDD:214776 | 31/122 (25%) |
| TwdlR | NP_733161.2 | DUF243 | 69..165 | CDD:281144 | 24/95 (25%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | P | PTHR31927 |
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 2.010 | |||||