Sequence 1: | NP_610706.1 | Gene: | Sln / 36263 | FlyBaseID: | FBgn0033657 | Length: | 855 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001037956.1 | Gene: | LOC733714 / 733714 | -ID: | - | Length: | 425 | Species: | Xenopus tropicalis |
Alignment Length: | 219 | Identity: | 51/219 - (23%) |
---|---|---|---|
Similarity: | 76/219 - (34%) | Gaps: | 51/219 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 209 RDSSTTTTESGGPNVEPPDGGYGWFIVFGAFSVQFWVAGLVKSYGVLYVEIMETFPSSTATVASW 273
Fly 274 IPAILSALCLVLAPLSSALCQRFSCRTVVFVGGIFCAMGMILSYFATSLLHLLLTFGVLTGIGGG 338
Fly 339 LSTTPGIVIVSQYF--DKHRALANGICVSGTAAGSFILPVLIKHLAENCGFHGTIL------ILG 395
Fly 396 G----CMLH------VCVSATLYR 409 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Sln | NP_610706.1 | MFS | 235..>411 | CDD:119392 | 44/193 (23%) |
MFS | <656..827 | CDD:119392 | |||
MFS_1 | 658..>847 | CDD:284993 | |||
LOC733714 | NP_001037956.1 | MFS_1 | 94..370 | CDD:284993 | 42/158 (27%) |
2_A_01_02 | 96..237 | CDD:273318 | 37/141 (26%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D916876at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |