DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sln and LOC733714

DIOPT Version :9

Sequence 1:NP_610706.1 Gene:Sln / 36263 FlyBaseID:FBgn0033657 Length:855 Species:Drosophila melanogaster
Sequence 2:NP_001037956.1 Gene:LOC733714 / 733714 -ID:- Length:425 Species:Xenopus tropicalis


Alignment Length:219 Identity:51/219 - (23%)
Similarity:76/219 - (34%) Gaps:51/219 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   209 RDSSTTTTESGGPNVEPPDGGYGWFIVFGAFSVQFWVAGLVKSYGVLYVEIMETFPSSTATVASW 273
            |||....|||.|...:                              .|.|  :.:.:....:...
 Frog    65 RDSIINNTESAGNQTQ------------------------------CYEE--KDYLNEENVLVGL 97

  Fly   274 IPAILSALCLVLAPLSSALCQRFSCRTVVFVGGIFCAMGMILSYFATSLLHLLLTFGVLTGIGGG 338
            :.||.:.|.|:..|:...:..|......:|.|.|...:..::..||.|...|.:..| |.|||..
 Frog    98 LLAIKALLQLLTNPIVGKIINRTGYDAPLFCGTIIMFLSTLMFAFADSYAFLCVARG-LQGIGSS 161

  Fly   339 LSTTPGIVIVSQYF--DKHRALANGICVSGTAAGSFILPVLIKHLAENCGFHGTIL------ILG 395
            .:..|.:.:::..|  |..|..|.||.:||.|.|....|.....:.|..|.....|      :|.
 Frog   162 FTAVPALGMLAHVFPDDAERGKAMGIALSGVAIGVLAGPPFGSAMYEFVGKSAPFLAIAALALLD 226

  Fly   396 G----CMLH------VCVSATLYR 409
            |    |:|.      |.|.||.|:
 Frog   227 GVLQLCILRPTRFSTVDVPATPYK 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SlnNP_610706.1 MFS 235..>411 CDD:119392 44/193 (23%)
MFS <656..827 CDD:119392
MFS_1 658..>847 CDD:284993
LOC733714NP_001037956.1 MFS_1 94..370 CDD:284993 42/158 (27%)
2_A_01_02 96..237 CDD:273318 37/141 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D916876at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.