DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment INHBC and scw

DIOPT Version :9

Sequence 1:NP_005529.1 Gene:INHBC / 3626 HGNCID:6068 Length:352 Species:Homo sapiens
Sequence 2:NP_001286088.1 Gene:scw / 46000 FlyBaseID:FBgn0005590 Length:400 Species:Drosophila melanogaster


Alignment Length:386 Identity:91/386 - (23%)
Similarity:141/386 - (36%) Gaps:92/386 - (23%)


- Green bases have known domain annotations that are detailed below.


Human    36 LESQREL--LLDLAKRSILDKLHLTQRPTLNRPVSRAALRT--------------ALQHLHGVPQ 84
            |..|.|:  :|||.     |:......|.|:...|:..|..              ..:|...:..
  Fly    36 LSEQMEMIDILDLG-----DRPRRQAEPNLHNSASKFLLEVYNEISEDQEPKEVLHQRHKRSLDD 95

Human    85 GALLEDNREQE---C-EIISFAETGLSTINQTRLDFH--FSSDRTAGDREVQQASLMFFVQLPS- 142
            ..|:.:...||   | .|::|:...........||.|  |:::....|..:.||.|..:.| || 
  Fly    96 DILISNEDRQEIASCNSILTFSSRLKPEQLDNELDMHITFNTNDVPVDLSLVQAMLRIYKQ-PSL 159

Human   143 ---NTTWTLKV-RVL---------VLGPHNT----------NLTLATQYLLEVDASGWHQLPLGP 184
               ...:|:.| |.|         :||..||          |||...:|.|       |...|..
  Fly   160 VDRRANFTVSVYRKLDNRQDFSYRILGSVNTTSSQRGWLEFNLTDTLRYWL-------HNKGLQR 217

Human   185 EAQAACSQGHLTLELVLEG----QVAQSSV--ILGGAAHRPFVAARV-RVGGKHQIHRRGIDCQG 242
            ..:...|.|...|.....|    |.:::|:  .:.|..:.|.:..:: ::..|..:.:|  ...|
  Fly   218 RNELRISIGDSQLSTFAAGLVTPQASRTSLEPFIVGYFNGPELLVKIQKLRFKRDLEKR--RAGG 280

Human   243 GS---------------RMCCRQEFFVDFREIGWHDWIIQPEGYAMNFCIGQC--PLHIAGMPGI 290
            ||               :.|.|..|.|||:|:..|:|:|.|:.:...||.|.|  ||...    :
  Fly   281 GSPPPPPPPPVDLYRPPQSCERLNFTVDFKELHMHNWVIAPKKFEAYFCGGGCNFPLGTK----M 341

Human   291 AASFHTAVLNLLKANTAAGTTGGGSCCVPTARRPLSLLYYDRDSNIVKTDIPDMVVEACGC 351
            .|:.|..|..|:.........   .|||||....:::|.|..:..|..|.....|.:.|||
  Fly   342 NATNHAIVQTLMHLKQPHLPK---PCCVPTVLGAITILRYLNEDIIDLTKYQKAVAKECGC 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
INHBCNP_005529.1 TGFB 247..352 CDD:214556 34/107 (32%)
scwNP_001286088.1 TGFb_propeptide 39..254 CDD:279078 49/227 (22%)
TGFB 300..400 CDD:214556 34/107 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.