DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13192 and ASA1

DIOPT Version :9

Sequence 1:NP_610702.1 Gene:CG13192 / 36259 FlyBaseID:FBgn0033653 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_015410.2 Gene:ASA1 / 856200 SGDID:S000006289 Length:443 Species:Saccharomyces cerevisiae


Alignment Length:342 Identity:63/342 - (18%)
Similarity:112/342 - (32%) Gaps:99/342 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 LLAGTIKGSVFLWDLQTNRSALHFEV-GSDPITSLH--HTPDRLVTQEKGGTITMFSIGGSS--- 89
            ||:|...|...:|||.|.|...|.|: |:..|.:..  .|.:.|....|...:.:|.:..|:   
Yeast    45 LLSGDNYGYFVMWDLVTKRPITHIEIEGNSHIIAFWWVETTNVLYILSKDSMLRIFELDSSTQLS 109

  Fly    90 -----------------YVKERSIPGNHLGFCRSALHTNT--SKTNEQLLFYPCEESSIGVLHVT 135
                             :.|...:|.|.|.|....:....  :|.|:......|        |..
Yeast   110 IDLVRKLSQANKTDHLQWTKIYEMPINTLNFANFIIEAEVKPTKDNKSYRLVCC--------HTD 166

  Fly   136 DAAAPTQILVPDD--------------PQL------------PKLGSVTCFKPFECASQLFLLAG 174
            |:.......:.:|              |:.            .|.|.:..|....  ..:||  |
Yeast   167 DSETIDIYQIIEDSTFKLKRPFNNINFPRFLKQQNFLGISKDSKFGIIMRFAKLN--DVIFL--G 227

  Fly   175 YESGHFLTWDIS--SSVILDVMELAQDATSVDYDPVTNRGIVGGPTDKLISFSYQ------RSSM 231
            ||:|..:.:.|:  ..:..|:.||...:.....:|:.:..:.|   |:|.|.|..      :..:
Yeast   228 YENGFVVGFKITFDEGLQRDIAELVHVSNDHYPNPILDMCVSG---DELYSCSTDDFITKYKIPV 289

  Fly   232 QMQLGSE------LCIKNPGVNGVRIRPDQKV-----------------FASAGWDGRIRIFSWK 273
            .:||.::      |.||.|  :.:|:....||                 ...:.|.|...:::.:
Yeast   290 NLQLETKYLRDDALLIKCP--SSLRVSEPSKVHLPLKNIGHIDKVKDDYLVVSSWSGMTIVYNMR 352

  Fly   274 SLRPLAVLTQHKNGGVM 290
            :........:.||..|:
Yeast   353 TSEVEQTFVKSKNNLVV 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13192NP_610702.1 WD40 <5..321 CDD:225201 63/342 (18%)
WD40 repeat 62..98 CDD:293791 6/57 (11%)
WD40 repeat 103..147 CDD:293791 6/45 (13%)
WD40 repeat 200..245 CDD:293791 11/56 (20%)
WD40 201..>321 CDD:295369 20/119 (17%)
WD40 repeat 247..282 CDD:293791 5/51 (10%)
ASA1NP_015410.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103807
Panther 1 1.100 - - LDO PTHR19854
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.