DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13192 and CG1671

DIOPT Version :9

Sequence 1:NP_610702.1 Gene:CG13192 / 36259 FlyBaseID:FBgn0033653 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_610526.1 Gene:CG1671 / 36019 FlyBaseID:FBgn0033454 Length:787 Species:Drosophila melanogaster


Alignment Length:316 Identity:60/316 - (18%)
Similarity:109/316 - (34%) Gaps:85/316 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LCFQ-ESDRLLAGTIKGSVF-LWDLQTNRSALHFEVGSDPITSLHHTPDRLVTQEKGGTITMFSI 85
            :||. |.||.||.......| |:|.:.:.:.......||.:.||..:.:.|::..|..::.::.:
  Fly   343 MCFMGEHDRYLAVATNSKHFKLYDTEHDMNCKLIVGHSDTVMSLAASQNLLISVGKDCSVRLWRL 407

  Fly    86 GGSSYVKERSIPGNHLGFCRSALHTNTSKTNEQLLFYPCEESSIGVLHVTDAAAPTQILVPDDPQ 150
                         .|...|  :|...|.:.|       |..|:||.:.:|...|           
  Fly   408 -------------QHDKDC--SLEALTQQAN-------CHTSTIGCVAMTHNGA----------- 439

  Fly   151 LPKLGSVTCFKPFECASQLFLLAGYESGHFLTWDISSSVILDVMELAQDATS---------VDYD 206
                      ..|...||        .|....|.:..|        .:|..|         :.:|
  Fly   440 ----------TGFASVSQ--------DGSMKVWQLVRS--------KEDRNSYSFNLRYAALSHD 478

  Fly   207 PVTNRGIVGGPTDKLISFSYQRSSMQMQLGSELCIK------NPGVNGVRIRPDQKVFASAGWDG 265
            ...| .:...|.:|||:.:.|..:.::.|.....::      ..||..||..|..::..::..|.
  Fly   479 KEVN-CVAYAPNNKLIATASQDKTAKVWLAESNTLQGVLRGHTRGVWSVRFSPVDQIVLTSSSDC 542

  Fly   266 RIRIFSWKSLRPLAVLTQHKNGGVMDLAFSSQQVAMWHAPIMAAAGMDGQISLWDL 321
            .:||:|..:...:....|...  ::...|      :.|...:.:|..||.:.||::
  Fly   543 TLRIWSISNFSCIKRFDQECT--ILRAEF------LDHGKFIISAASDGLLKLWNI 590

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13192NP_610702.1 WD40 <5..321 CDD:225201 60/314 (19%)
WD40 repeat 62..98 CDD:293791 4/35 (11%)
WD40 repeat 103..147 CDD:293791 10/43 (23%)
WD40 repeat 200..245 CDD:293791 9/59 (15%)
WD40 201..>321 CDD:295369 26/134 (19%)
WD40 repeat 247..282 CDD:293791 7/34 (21%)
CG1671NP_610526.1 WD40 repeat 22..54 CDD:293791
WD40 64..571 CDD:225201 54/295 (18%)
WD40 repeat 82..115 CDD:293791
WD40 118..455 CDD:238121 31/162 (19%)
WD40 repeat 122..159 CDD:293791
WD40 repeat 167..206 CDD:293791
WD40 repeat 209..236 CDD:293791
WD40 repeat 299..335 CDD:293791
WD40 329..631 CDD:238121 60/316 (19%)
WD40 repeat 340..377 CDD:293791 10/33 (30%)
WD40 repeat 430..476 CDD:293791 11/82 (13%)
WD40 repeat 481..517 CDD:293791 7/36 (19%)
WD40 repeat 524..559 CDD:293791 7/34 (21%)
WD40 repeat 564..600 CDD:293791 7/33 (21%)
WD40 repeat 608..657 CDD:293791
Utp13 653..787 CDD:285789
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19854
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.