DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13192 and Gnb1l

DIOPT Version :9

Sequence 1:NP_610702.1 Gene:CG13192 / 36259 FlyBaseID:FBgn0033653 Length:323 Species:Drosophila melanogaster
Sequence 2:XP_011244130.1 Gene:Gnb1l / 13972 MGIID:1338057 Length:400 Species:Mus musculus


Alignment Length:236 Identity:75/236 - (31%)
Similarity:112/236 - (47%) Gaps:45/236 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 TSKTNEQLLFYP-------CEESSIGVLHVTDAAAPTQILVPDDPQLPKLGSVTCFKP------- 162
            |:|.|.....:|       .|:::.|.     .|...|||     ::|...||...||       
Mouse   182 TNKKNSYHSKWPWGPGCNLAEDTATGT-----PAPQVQIL-----EMPSKTSVCTLKPEADARPG 236

  Fly   163 -------FECASQL--FLLAGYESGHFLTWDISSSVILDVMELAQD-ATSVDYDPVTNRGIVGGP 217
                   ::..|.|  .||||||.|....||||...:...:...:: ...:|:|....:||.|..
Mouse   237 MPMCLGLWQTNSSLRPLLLAGYEDGSVTLWDISERKVCSQITCHEEPVMGLDFDSQKAKGISGSA 301

  Fly   218 TDKLISFSY-QRSSMQMQLGSELCIKNPGVNGVRIRPDQKVFASAGWDGRIRIFSWKSLRPLAVL 281
            ...|..:|. .:.|:|::...||  .|||:..|.||||.|:.|:||||.|||:|.|::::|||||
Mouse   302 GKVLAVWSLDDQQSLQVKKTHEL--TNPGIAEVTIRPDHKILATAGWDHRIRVFHWRTMKPLAVL 364

  Fly   282 TQHKNGGVMDLAFSSQQVAMWHAPIMAAAGMDGQISLWDLY 322
            ..| :..|..:||::.       .::||...|.:||:|.||
Mouse   365 AFH-SAPVYCVAFAAD-------GLLAAGSKDQRISIWSLY 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13192NP_610702.1 WD40 <5..321 CDD:225201 73/233 (31%)
WD40 repeat 62..98 CDD:293791
WD40 repeat 103..147 CDD:293791 10/41 (24%)
WD40 repeat 200..245 CDD:293791 12/45 (27%)
WD40 201..>321 CDD:295369 45/120 (38%)
WD40 repeat 247..282 CDD:293791 20/34 (59%)
Gnb1lXP_011244130.1 WD40 248..>396 CDD:392136 58/157 (37%)
WD40 repeat 285..324 CDD:293791 9/38 (24%)
WD40 repeat 329..365 CDD:293791 20/35 (57%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I11437
eggNOG 1 0.900 - - E2759_KOG0322
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41515
Inparanoid 1 1.050 113 1.000 Inparanoid score I4847
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55530
OrthoDB 1 1.010 - - D1543596at2759
OrthoFinder 1 1.000 - - FOG0006340
OrthoInspector 1 1.000 - - oto93710
orthoMCL 1 0.900 - - OOG6_103807
Panther 1 1.100 - - LDO PTHR19854
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R93
SonicParanoid 1 1.000 - - X4617
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.870

Return to query results.
Submit another query.