DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ths and fgf16

DIOPT Version :10

Sequence 1:NP_610701.2 Gene:ths / 36258 FlyBaseID:FBgn0033652 Length:748 Species:Drosophila melanogaster
Sequence 2:NP_001035497.1 Gene:fgf16 / 692065 ZFINID:ZDB-GENE-060427-3 Length:203 Species:Danio rerio


Alignment Length:83 Identity:18/83 - (21%)
Similarity:31/83 - (37%) Gaps:7/83 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 CAHNKAIHIAAEGTVSVT--DTSQIQNITIVGFPDYLNNEFKIALYAKETRRYLCFNDNWRLVGM 93
            |.....:.|...|||..|  |.|:...:..:.....|     :::...:...||..|:...|.|.
Zfish    63 CRTGFQLEIFPNGTVHGTRQDHSRFGILEFISLAVGL-----VSIRGVDAGLYLGMNEKGELYGS 122

  Fly    94 RELRDTCYFNETIVHGYF 111
            ::|...|.|.|.....::
Zfish   123 KKLTAECVFREQFEENWY 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thsNP_610701.2 beta-trefoil_FGF8-like 25..148 CDD:466993 18/83 (22%)
fgf16NP_001035497.1 beta-trefoil_FGF 51..200 CDD:469595 18/83 (22%)

Return to query results.
Submit another query.