DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ths and fgf18b

DIOPT Version :10

Sequence 1:NP_610701.2 Gene:ths / 36258 FlyBaseID:FBgn0033652 Length:748 Species:Drosophila melanogaster
Sequence 2:NP_001012379.1 Gene:fgf18b / 497639 ZFINID:ZDB-GENE-050221-4 Length:213 Species:Danio rerio


Alignment Length:82 Identity:25/82 - (30%)
Similarity:40/82 - (48%) Gaps:4/82 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 KIALYAKETRRYLCFNDNWRLVGMRE--LRDTCYFNETIV-HGYFVFRSVVDLQRRVGFTHRGKP 131
            ::.:..|||..|||.|...:|:|.::  :...|.|.|.:: :.|..:.|...:...||||.:|:|
Zfish    96 QVRIRGKETNYYLCMNRKGKLIGKKDSSVNGGCVFIEIMLENNYTAWMSAHYVGWYVGFTKKGRP 160

  Fly   132 -VGPKKSVNDACYMFNK 147
             .||....|.....|.|
Zfish   161 RRGPNTLPNQRDVHFMK 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thsNP_610701.2 beta-trefoil_FGF8-like 25..148 CDD:466993 25/82 (30%)
fgf18bNP_001012379.1 beta-trefoil_FGF18 53..179 CDD:467010 25/82 (30%)

Return to query results.
Submit another query.