DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ths and fgf8

DIOPT Version :10

Sequence 1:NP_610701.2 Gene:ths / 36258 FlyBaseID:FBgn0033652 Length:748 Species:Drosophila melanogaster
Sequence 2:NP_001008163.1 Gene:fgf8 / 493525 XenbaseID:XB-GENE-480983 Length:211 Species:Xenopus tropicalis


Alignment Length:146 Identity:34/146 - (23%)
Similarity:55/146 - (37%) Gaps:43/146 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSNQLERLLFFIVVISGALCTVEDYVIMS-------QCAHNKAIHIAAEG------TVSVTDTSQ 52
            :::||.|.|            :..|.:.|       |...||.|:..||.      .:..|||  
 Frog    42 VTDQLSRRL------------IRTYQLYSRTSGKHVQILGNKKINAMAEDGDPHAKLIVETDT-- 92

  Fly    53 IQNITIVGFPDYLNNEFKIALYAKETRRYLCFNDNWRLVGMRELR-DTCYFNETIV-HGYFVFRS 115
                    |..      ::.:...||..|:|.|...:|:|....| ..|.|:|.:: :.|...::
 Frog    93 --------FGS------RVRIKGAETGYYICMNKKGKLIGKTSGRGKDCVFSEIVLENNYTALQN 143

  Fly   116 VVDLQRRVGFTHRGKP 131
            |......:.||.||:|
 Frog   144 VKYEGWYMAFTRRGRP 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thsNP_610701.2 beta-trefoil_FGF8-like 25..148 CDD:466993 30/122 (25%)
fgf8NP_001008163.1 beta-trefoil_FGF8 32..178 CDD:467008 34/146 (23%)

Return to query results.
Submit another query.