DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ths and fgf17

DIOPT Version :10

Sequence 1:NP_610701.2 Gene:ths / 36258 FlyBaseID:FBgn0033652 Length:748 Species:Drosophila melanogaster
Sequence 2:XP_073765402.1 Gene:fgf17 / 407737 ZFINID:ZDB-GENE-040621-1 Length:216 Species:Danio rerio


Alignment Length:73 Identity:20/73 - (27%)
Similarity:35/73 - (47%) Gaps:8/73 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 KIALYAKETRRYLCFNDNWRLVGMRELRD-TCYFNETIVHGYFVFRSVVDLQRR----VGFTHRG 129
            ::.:...|:.||||.|...:|||....|. .|.|.|.::...:   :.::..|.    |.||.:|
Zfish    97 RVRIKGAESGRYLCMNRRGKLVGKPNGRGRDCIFTEIVLENNY---TALENARHEGWFVAFTRKG 158

  Fly   130 KPVGPKKS 137
            :|:...|:
Zfish   159 RPIRASKT 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thsNP_610701.2 beta-trefoil_FGF8-like 25..148 CDD:466993 20/73 (27%)
fgf17XP_073765402.1 None

Return to query results.
Submit another query.